Os11t0684100-01

Locus

Os11g0684100

Description

NB-ARC domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY125

CGSNL Gene Name

WRKY GENE 125

Oryzabase Gene Symbol Synonym(s)

OsWRKY125

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK121102 (DDBJ, Best hit)

Protein Evidence

Q6IEP0 (UniProt)

Literature

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

Gene Ontology (GO)

Biological Process: defense response (GO:0006952)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

Disease resistance protein (IPR000767)

NB-ARC (IPR002182)

Full-length cDNA

J023069N11 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0684100-01)

RiceXPro (AK121102)

Others

Oryzabase (9227)

KEGG (Os11t0684100-01)

Transcript

4794 bp

>Os11t0684100-01 NB-ARC domain containing protein.
ACTTTAGGTCCCCTAAGATCGACAACCTGGAGCCCGACGACGACGAGGGGATGGGGAGGG
GAAGAGCGGCGGCGCGCACCGCCGCGTCCCAATTCCCACGGCAATGGAGGCACGCTACCT
GCGAGTACGAGGGGGGGAGCTCCATCTTGTTCTTCTGCGCCCGTCCATTCTTCTTCCTCC
GTCCGTCCATCTGGTCGATCCTCGATGGGCGGATGGGGCGGAGGGAGCCCTCGTCTGCAT
CGCGGCCGGCCGGCCGCCGGATTCGGGATACTTGAGGATTGGTGTGTAAAGCATATATCT
TGAAAGGTGCTTCAGTGCTTGTCAAGTAGTGATTATTGAAGTGTCCAACAGCTACACCAC
ACAGTGGCCAATCGATCATTTATTCTGAAGAAAATATTGTTGAATGGCTGAATTGACCAG
ACGACCACTGTTGGCTGCAAACCGAAAGCTAATCCTCAAGGAGAGGAAAGCATTGGATTT
GGAAGCTAGGAATGAAGCAAAATGGAAGAACTCTCTCCTAAGTCCAACCGCTTGGAGAGC
TCGCTCATGCTACTCTGATCATCTGATGCCTTCAGCTTAGAAGATATCAATGGAGGGCTC
CATGTTCAACCTCCCAGGAAGGCTCGACCGGCTCCTGCGTCGTCATGGCAGCATGCTGCC
CAAGGGGGCAGAGGAGGAGATACCTCTCATCAAGCAAGATCTCGAGGAAATAATCTCCGT
CCTCCATGGTCACTGTAGCAAGCCAAAGCTGGAGGACCATGCCATGGTGGTCAGGTGctg
gatgaaggaggtacgtgagctctcttatgacatcgaggattgcatcgaccagtatgagca
tgccgccactgccacccggTCACATACTGGACCTAATATTTGTCGCCGTAAGTTCAATCA
GCGGCATGGAAAGATGATCCCTTGGGTTCCCTGGAAACTTAAGCAGCGGTTGTGGATGGC
CAACAAGATCAGAGAATTCAGCCTGCGCACCCAGGAGGCGCTTCAACGCCACACCATGTA
CAACAACCTTGGTGGCATCACCATTGCTTCTACTACTGGAGGAGATGTATGCTCTGCAAC
ACCTTGGCATCCCACGCAGTTCAGAGAGCACACCGACAACGTCTGTTCTGTCGGTATAGA
CGCCGATGGTATGGAAGCTGCCCTGAATGACCTGAACAAGCTCAAAAACTTGCTCGCTAG
TATCCCGACTGCTTCTCTCGTGCAGTTCAGGGAGCACGCCAATAAAGTGCGTCATATCCA
CCCCGATGTGGAAGCCATCCTGAACAAGCTCAAAAACATACCCACTGGTATCACCACTAC
TTCTACTACCACTAGAGGTGATGTATCTTCTACCTCATCTAGGCAACCCACGCGGTTCAT
Ggagtccgcgggtcttgttggcatcaacgccgcggtgaacaagcttgaaaacttgctcga
tgtgtgcggagaggagaagctcaaggtggtgtccatcgtgggagttggaggagttggcaa
gactacgctcgccaacaagctgtactgcaagcttcagcggcagttcgagtgctgggcatt
tgtgcagacatctcagaagactgatatgaggaggcttctcatcaatatcctctcacaggt
tcagccgcaccagtcacctgacaattggaaggtgcatagcctaatttccagtatcaggac
acatctgcaagataagaggtacttgatcataattgatggtttatgggctacatccacatg
ggatgttattaagtgcgctttgccggatggtaatagttccagcagaatactaaccacaac
agaaattgaggatctagctttgcaatcttgtagttatgacttgaaatttattttcaagat
gaaaccttttggtgagggtgactcaagaaaactatttttcagtatagtctttggctctca
ttctaagtgtcctccagaagtcagtgaaacattatatgatattgtaaggaaatgtggtgg
tttgccgctagctattgtcactgttgctagtcttttagcaagccagcttgagaaacaaga
acaattggattatataaacaaatccttaggttacggtttgatggcaaatcctactttgga
agggatgaaacaactactgaacatttgttacaacaatcttcctcagcatttgaaggtatg
catgttgtatcttagtatgtatcaagaagatcacataatttggaaagatgatttagtgag
tcaatggatagctgaaggttttatctgtgcaactgaagggcatgacaaggaagaaatttc
aagggcctattttgatgagcttgtgggcagaaaaatcatccagccTGTACATATCGATGA
CAGTGGTGAGGTTTTGTCCTGTGTAGTTCACCATATGGTACTCAATTTCGTTACATACAA
GTCAATAGAAGAAAATTTTATTATTGCAATAGACCATTCACAGGCAACTATAAGATTTGC
TGACAAGGTTCGACGATTATCTATCCACTTTAGTAACGTAGAAGATGCAACTCCGCCTAC
CAGTATGAGATTGTCCCAAGTTCGGACAGTTGCCTTCTTCGGGGTCTTGAAGTATATGCC
TTTCGTTATGGAGTTTCGACTTATTAAAGTTCTAGTTCTACATATTTTGGGTGATGAGGA
TAGCATCGGCATTTTTGATCTCACTAAAATTTCAGAACTTGTTCGACTGAGATATTTGAA
GGTCACCTCTAATGTCACCGTAAAACTGCCAACCCAGATGCAAGGTCTACCATATTTGGA
GACACTGAAAATAGATGGGACAATAAGTGAAGTTCCAACAGACATTTATTTGCCACGTTT
GCTGCATCTTACTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATTGTCCACATGACATC
GCTTCGTACAATTGGATATTTTGATCTCAGCTGTAACTCAGCGGAGAATCTATGGAGCCT
TGGTGAGCTGAGCAATCTCCGGGATTTGCAGCTCACCTATTCTGAAATACATTCTGACAA
TCTGAAGGATAATATGAAATATCTTGGATCCATTCTGGGGAAACTCCGTAATCTCACATC
TATAACTTTATCGCCTCCTGGCTCTTCCTGTCCAGATACTCTACATATTGACAGGACGAG
GATCAATGTTGATGGCTGGAGCAGTGTGTCCTCTCCACCAGCCCTTCTTCAGAGGTTTGA
GTTGTTACCATGTGTTTGCATCTTTTCTAACCTCCCAAATTGGATTGGGCAGCTTGGAAA
CCTCTGCATTTTGAAGATTGGGATAAGGGAAGTAACAAGTAATAGTATTGATGTTCTAGG
AGTATTACCGAAACTCACTGTTTTGTCACTTTATGTCCACACAAAGCCTGCAGAAAGGAT
TGTCTTTGACAATGCAGGGTTCTCAATCCTCAAATACTTCGAGTTTATATGCAGTGTAGC
ATGGATGAAATTTGAGATGGGTGCAATGCCTAGTCTAAGGAAGCTCAAGCTAGGTTTTGA
TGTCCATATAGCAGATCAGCATGATATTATTCCTGTTGGCATCGAACATCTGTCTGGACT
TGAAGAGATCTCTGCAAAAATTAGGGTCGCCTGTACTGCTCATGATCATTGTAGAAGATT
TGCAGAGTCAGCTTTGACTAACGCCTTTATGATGCATCCAGGACGTCCTAGCGTCAACAT
ACGGTGTGTGGATTGGACCTTTCATGATAAGGATAATGACTGTGTGGGGACACGAGAGGA
AGAATGTAGGACTCCAATGAAACAGGAGCATTTTGTGAAAGAAGACTTAAGTGAGAAATC
TGCAGTTCTACAAAACGAGCACGACGAAGAAGCACATAAATTTGTTGACAGAAGATATTA
TCCCATCATGGACGCGGCAGAGATCCGCAGGTGTCCGTGGAGCGTCAACGAGGAGCAGGA
GCAGCCGGTGTTGATCTACGACGCCAGAACCAAGATCTCCCAGTCGTCGTCCATGCACAG
CGAATTCTGGGCGGCCGTCCAACGGCTCACCGGCCCAGCTGCCACGCCGGCCAAGACCAA
GAGGCACCTCCACCTGACGACCTCGCCTGAGCTGGAGGACGGCTTCTTGCCGGTACGTAG
TCTCGTCTTCCCGTCCGCTCCGGATCCACGGTGCAACATGAAGAAGAAGAAGATGagggc
cggccctggagggggtcgagcagtgcggtcaaactgggcccccaaatcgtaggggcccca
ACCCAGGGAGCCTGCAAAGCCTCTCTTCTGCAACAAAGCCATGCGATGAGATGATGCGAA
CAGAAACGCCCAATTCCTACTGCAAAGCCTCTCAGTGCCTTGCCGCCTGCCGAGTTGCCG
TCGACCGCCCCGGCGCCGCCGTTGGCTGCTGCTGCAAGCCTGAAGACAGCTGCAACTGCT
GATTTGCTAAACTGCGCACCTCAGCCTAACGATCAAAACTAAAAGTCTCAAGAGGTGTTG
ATGATGCGAAGTGATCAGGTGAGCAGCAGCATGCCAGCAACACCGTCGCCATCGCCAATT
GAGATTTGTTTTAATTCTATGATTTTATCTGTTGGTTGTTGGTCTATTGCCATCATGCCA
TGTACTGATGAACAGACGTATATATACATGCACTACTATGTTCCATGTTAGGTTAATAGG
TTTGTGACTTACTGACTTTGTGTCTGTCTCTTATTTTTTTAGTTGTTTAAAAGATCTGAG
TTCAGAGGGATTGAGCTTGGAGACGTGCTAGTGTGTGATGAGTCGTGCGCATCCGGACGT
CTGTGAATATTTAATTGGTAAGACTTTAAATTTGAATTTGTAGTTTTATGGTGT

CDS

3603 bp

>Os11t0684100-01 NB-ARC domain containing protein.
ATGGAGGGCTCCATGTTCAACCTCCCAGGAAGGCTCGACCGGCTCCTGCGTCGTCATGGC
AGCATGCTGCCCAAGGGGGCAGAGGAGGAGATACCTCTCATCAAGCAAGATCTCGAGGAA
ATAATCTCCGTCCTCCATGGTCACTGTAGCAAGCCAAAGCTGGAGGACCATGCCATGGTG
GTCAGGTGctggatgaaggaggtacgtgagctctcttatgacatcgaggattgcatcgac
cagtatgagcatgccgccactgccacccggTCACATACTGGACCTAATATTTGTCGCCGT
AAGTTCAATCAGCGGCATGGAAAGATGATCCCTTGGGTTCCCTGGAAACTTAAGCAGCGG
TTGTGGATGGCCAACAAGATCAGAGAATTCAGCCTGCGCACCCAGGAGGCGCTTCAACGC
CACACCATGTACAACAACCTTGGTGGCATCACCATTGCTTCTACTACTGGAGGAGATGTA
TGCTCTGCAACACCTTGGCATCCCACGCAGTTCAGAGAGCACACCGACAACGTCTGTTCT
GTCGGTATAGACGCCGATGGTATGGAAGCTGCCCTGAATGACCTGAACAAGCTCAAAAAC
TTGCTCGCTAGTATCCCGACTGCTTCTCTCGTGCAGTTCAGGGAGCACGCCAATAAAGTG
CGTCATATCCACCCCGATGTGGAAGCCATCCTGAACAAGCTCAAAAACATACCCACTGGT
ATCACCACTACTTCTACTACCACTAGAGGTGATGTATCTTCTACCTCATCTAGGCAACCC
ACGCGGTTCATGgagtccgcgggtcttgttggcatcaacgccgcggtgaacaagcttgaa
aacttgctcgatgtgtgcggagaggagaagctcaaggtggtgtccatcgtgggagttgga
ggagttggcaagactacgctcgccaacaagctgtactgcaagcttcagcggcagttcgag
tgctgggcatttgtgcagacatctcagaagactgatatgaggaggcttctcatcaatatc
ctctcacaggttcagccgcaccagtcacctgacaattggaaggtgcatagcctaatttcc
agtatcaggacacatctgcaagataagaggtacttgatcataattgatggtttatgggct
acatccacatgggatgttattaagtgcgctttgccggatggtaatagttccagcagaata
ctaaccacaacagaaattgaggatctagctttgcaatcttgtagttatgacttgaaattt
attttcaagatgaaaccttttggtgagggtgactcaagaaaactatttttcagtatagtc
tttggctctcattctaagtgtcctccagaagtcagtgaaacattatatgatattgtaagg
aaatgtggtggtttgccgctagctattgtcactgttgctagtcttttagcaagccagctt
gagaaacaagaacaattggattatataaacaaatccttaggttacggtttgatggcaaat
cctactttggaagggatgaaacaactactgaacatttgttacaacaatcttcctcagcat
ttgaaggtatgcatgttgtatcttagtatgtatcaagaagatcacataatttggaaagat
gatttagtgagtcaatggatagctgaaggttttatctgtgcaactgaagggcatgacaag
gaagaaatttcaagggcctattttgatgagcttgtgggcagaaaaatcatccagccTGTA
CATATCGATGACAGTGGTGAGGTTTTGTCCTGTGTAGTTCACCATATGGTACTCAATTTC
GTTACATACAAGTCAATAGAAGAAAATTTTATTATTGCAATAGACCATTCACAGGCAACT
ATAAGATTTGCTGACAAGGTTCGACGATTATCTATCCACTTTAGTAACGTAGAAGATGCA
ACTCCGCCTACCAGTATGAGATTGTCCCAAGTTCGGACAGTTGCCTTCTTCGGGGTCTTG
AAGTATATGCCTTTCGTTATGGAGTTTCGACTTATTAAAGTTCTAGTTCTACATATTTTG
GGTGATGAGGATAGCATCGGCATTTTTGATCTCACTAAAATTTCAGAACTTGTTCGACTG
AGATATTTGAAGGTCACCTCTAATGTCACCGTAAAACTGCCAACCCAGATGCAAGGTCTA
CCATATTTGGAGACACTGAAAATAGATGGGACAATAAGTGAAGTTCCAACAGACATTTAT
TTGCCACGTTTGCTGCATCTTACTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATTGTC
CACATGACATCGCTTCGTACAATTGGATATTTTGATCTCAGCTGTAACTCAGCGGAGAAT
CTATGGAGCCTTGGTGAGCTGAGCAATCTCCGGGATTTGCAGCTCACCTATTCTGAAATA
CATTCTGACAATCTGAAGGATAATATGAAATATCTTGGATCCATTCTGGGGAAACTCCGT
AATCTCACATCTATAACTTTATCGCCTCCTGGCTCTTCCTGTCCAGATACTCTACATATT
GACAGGACGAGGATCAATGTTGATGGCTGGAGCAGTGTGTCCTCTCCACCAGCCCTTCTT
CAGAGGTTTGAGTTGTTACCATGTGTTTGCATCTTTTCTAACCTCCCAAATTGGATTGGG
CAGCTTGGAAACCTCTGCATTTTGAAGATTGGGATAAGGGAAGTAACAAGTAATAGTATT
GATGTTCTAGGAGTATTACCGAAACTCACTGTTTTGTCACTTTATGTCCACACAAAGCCT
GCAGAAAGGATTGTCTTTGACAATGCAGGGTTCTCAATCCTCAAATACTTCGAGTTTATA
TGCAGTGTAGCATGGATGAAATTTGAGATGGGTGCAATGCCTAGTCTAAGGAAGCTCAAG
CTAGGTTTTGATGTCCATATAGCAGATCAGCATGATATTATTCCTGTTGGCATCGAACAT
CTGTCTGGACTTGAAGAGATCTCTGCAAAAATTAGGGTCGCCTGTACTGCTCATGATCAT
TGTAGAAGATTTGCAGAGTCAGCTTTGACTAACGCCTTTATGATGCATCCAGGACGTCCT
AGCGTCAACATACGGTGTGTGGATTGGACCTTTCATGATAAGGATAATGACTGTGTGGGG
ACACGAGAGGAAGAATGTAGGACTCCAATGAAACAGGAGCATTTTGTGAAAGAAGACTTA
AGTGAGAAATCTGCAGTTCTACAAAACGAGCACGACGAAGAAGCACATAAATTTGTTGAC
AGAAGATATTATCCCATCATGGACGCGGCAGAGATCCGCAGGTGTCCGTGGAGCGTCAAC
GAGGAGCAGGAGCAGCCGGTGTTGATCTACGACGCCAGAACCAAGATCTCCCAGTCGTCG
TCCATGCACAGCGAATTCTGGGCGGCCGTCCAACGGCTCACCGGCCCAGCTGCCACGCCG
GCCAAGACCAAGAGGCACCTCCACCTGACGACCTCGCCTGAGCTGGAGGACGGCTTCTTG
CCGGTACGTAGTCTCGTCTTCCCGTCCGCTCCGGATCCACGGTGCAACATGAAGAAGAAG
AAGATGagggccggccctggagggggtcgagcagtgcggtcaaactgggcccccaaatcg
tag

Protein

1201 aa

>Os11t0684100-01 NB-ARC domain containing protein.
MEGSMFNLPGRLDRLLRRHGSMLPKGAEEEIPLIKQDLEEIISVLHGHCSKPKLEDHAMV
VRCWMKEVRELSYDIEDCIDQYEHAATATRSHTGPNICRRKFNQRHGKMIPWVPWKLKQR
LWMANKIREFSLRTQEALQRHTMYNNLGGITIASTTGGDVCSATPWHPTQFREHTDNVCS
VGIDADGMEAALNDLNKLKNLLASIPTASLVQFREHANKVRHIHPDVEAILNKLKNIPTG
ITTTSTTTRGDVSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCGEEKLKVVSIVGVG
GVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLIS
SIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKF
IFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQL
EKQEQLDYINKSLGYGLMANPTLEGMKQLLNICYNNLPQHLKVCMLYLSMYQEDHIIWKD
DLVSQWIAEGFICATEGHDKEEISRAYFDELVGRKIIQPVHIDDSGEVLSCVVHHMVLNF
VTYKSIEENFIIAIDHSQATIRFADKVRRLSIHFSNVEDATPPTSMRLSQVRTVAFFGVL
KYMPFVMEFRLIKVLVLHILGDEDSIGIFDLTKISELVRLRYLKVTSNVTVKLPTQMQGL
PYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAEN
LWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHI
DRTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNSI
DVLGVLPKLTVLSLYVHTKPAERIVFDNAGFSILKYFEFICSVAWMKFEMGAMPSLRKLK
LGFDVHIADQHDIIPVGIEHLSGLEEISAKIRVACTAHDHCRRFAESALTNAFMMHPGRP
SVNIRCVDWTFHDKDNDCVGTREEECRTPMKQEHFVKEDLSEKSAVLQNEHDEEAHKFVD
RRYYPIMDAAEIRRCPWSVNEEQEQPVLIYDARTKISQSSSMHSEFWAAVQRLTGPAATP
AKTKRHLHLTTSPELEDGFLPVRSLVFPSAPDPRCNMKKKKMRAGPGGGRAVRSNWAPKS
*

5'UTR

chr11:27694806..27695070 (- strand) : 265 bp

chr11:27690182..27690494 (- strand) : 313 bp

chr11:27690036..27690046 (- strand) : 11 bp

CDS

chr11:27688927..27690035 (- strand) : 1109 bp

chr11:27686156..27688291 (- strand) : 2136 bp

chr11:27684382..27684739 (- strand) : 358 bp

3'UTR

chr11:27683780..27684381 (- strand) : 602 bp

FASTA

>Os11t0684100-01 class=Sequence position=chr11:27683780..27695070 (- strand)
ACTTTAGGTC CCCTAAGATC GACAACCTGG AGCCCGACGA CGACGAGGGG ATGGGGAGGG GAAGAGCGGC GGCGCGCACC
GCCGCGTCCC AATTCCCACG GCAATGGAGG CACGCTACCT GCGAGTACGA GGGGGGGAGC TCCATCTTGT TCTTCTGCGC
CCGTCCATTC TTCTTCCTCC GTCCGTCCAT CTGGTCGATC CTCGATGGGC GGATGGGGCG GAGGGAGCCC TCGTCTGCAT
CGCGGCCGGC CGGCCGCCGG ATTCGGTGAG TCCTCCACAC AGGATCTGAA TAGCGGTGTT GTCCTATTGA TTTGTTGCAT
TATTCTGGTG AGATGAGATG AGAAGGAAGC TCCGTCAGAA TTTACAACTT GGGGGACTTT GTTTTGATCG ACGAGGGCAC
ACTGATTAAG TCATCATGCG TGTTTTACAT TCTTCGTAAG AAGAACTACT AGTAGTCCTT AAAGTTGAAC TTCAACTACA
TTCAGTTTTT GTTTCAGTAA GAAAAGCAGA AATTTCAGAC ATTAACCCAT GTTTTTTACA CGAAACTCGG TTCATAATTT
GGGTATCCCG ATATATAGGA TACATTTAAC TCTGCAAAAG GTCAATATTA CAGTCTTTAT TGCAGCCTGT CTGCTTAAGT
TGTATAAATG TGCTAGAGAT TTGCCATGGA AGGCTGGGAT GCTGCTTCGG TGGCTGCTAC CACCACCGGA TGCggatggc
cggtcacctg aagctgcgaa gaagaagaag gctctgcaag tctcatcctc ttaaggctag aatctgaacc atcttctgaa
ctttcttggc ctatagaact tttccccctc ccccttatgg cacagggtct tcccggttcc tcgctttcca ctggatcaac
ctttccgagc aacaaaactc taggcctgtt agggtggttc tttgcagctt gttcccaatc ttgccttgtt tgcgcagtca
ctccagagtc aatcgtaact tccttgagat ttttcaggtg tctgatctcg atgccggaaa gaccaactag tccttgacag
agcagctgaa gtgaaacaag gtttggtaga gctccttgct cgatttttgg ctgcgctaac gccacacttt tcaccacaaa
gcacaggcgt ctcaggctca gtagtgcttc atgttttatc tctaaattct cgagcttgtc agcaatcagt ttgaggtaca
gcagtctgtt cagatttatc agtgctgata gatgatcttg tgtcagagta gctggtgtaa tacacagatc aatgagacct
gacaaagaac taaaaaatgg aggcaaccgg agtaacttgc catgtatctt tagtgaactt agatggtatt tcgaatattc
agagcatggc tccaaatcaa gtgaacttag gaatttttca cagtattctt cggaatcaat tgagagagaa cggactctgt
ccatgtcaat gggagccttg gtaaattcct gaatggcctt tgaaagatca gcaatgtaat tactgctacc ttcaacatgc
ctgcaccata tcttaacctt cctcagtttt ttcatatgac caataagttg aagaaatcct ttcctcccgt cagtgataaa
tcctgctaaa gtttgcaagt tgcttttatt tgatgaaaac aattttaata gtttacttat cttcttcaca ttgttcagat
catctttgtg aagcataaac tttccaaaca agtgagctaa gtggggcagc atgatacctt caatgggcaa aaactttatc
tctgtttccc ttaaatccag tgtctctaaa caatgcagcc cttcaatact ccttggaagc tcactgatat tgcccccaag
gttcaggtat ttcagatgcc acggtgacag tacacatatg cgtttcagat gattatcgtt caaatcactg cattcttgta
gatccaagac tcgtatcaga ttgcacttgt gaagataaga aattgcatca cctgcatccc caaagattgt cagagatcgg
actcgagata attcctcgtc agatgccatg cattttgtct gtttagcagc atcaacagaa aggtggcgtg aattggtagt
attgattcca actcttggat catgcggtga tgtcgtgatg aatctcttgg ccaaggacct gttcagcaaa aattcatgca
taattccatg agttttgcac gtcttcactt cagaattgtt tcttgtgtca actggctgaa tgatattctg gtcaataagg
ttactgaaat tgtcatctgc agtgtcctct tcactgcgcc aagggtcatc acttcttgcg tttccttcag ctaaccaccg
ccggattaga actttcttcc tgagaggatg attgtttggg aatataccaa gatacagcaa gcaactcaga gcagagccgg
aaaaactgtc atagttgcca agaagcacct tcctgagttc tgaaaagttg tcatggccat ggtttcctgt cagatgagaa
cccagatcac ggcatagctt tgcacacaac tctcccgttg cctcagttga gctcttcaga taatcagaga cactgaccag
agcaagagga agaccatcac atttccctag taatgattct gaatggttct ccaactcagg tgatctaagc actgaaaaag
ctagttcctc agagtcttct ttaccaagtg tgttcatttg atacacataa ccattgccat ggctgcacct attagttact
gactgaatag ttgtggtaag taatatcctg ctgcctgtac cattattttc aaaggctgaa cttatgatcc tccattgatc
catcctgatg tcatcgatga taattaaata cctaataacc aaattgagaa ttgaggagga atattaagag ggtcaaattg
aaaaacaagg tgaaaaggtt aagtaaaaat aaattttcat atgcaatggt cattagtgaa caatctttta gataattaaa
ttagctaatt gaaccaagaa cattccacgt gaagagttat tggtgtactt aaaaatgaaa aatgttcttg taaaggaaat
aaaaataaaa gcgcctaacg gtgaggttca cctcttgtcc ttgaggtact ccttgagcga ggcttcaaga tgctggccat
cgacatccat ggcatcgccg ggacgcactt gctggagtac accgcgcagg atctccttca tccaattgct cgtttccggt
gagccatcag cggtgatcca cgcacggagg cagaatttat cctttgcatg agggctatcg tagaccgcct tggcgagggt
ggtcttcccc aagccactga accccacgat ggaggtcacc ctcaactgct ttggctcgcc ctccacttca tctagcagcg
agaggagctc ctccatgggc tgcctaatgc ccaccagact gtgcgcagca cgatacggag tcgatgacga tgacctggct
gattgacggg caataggtga attgatgttg acgactcact ggcgcacctc actgaggcgc ctcctgagct tctggatctc
ttcactgaag ctcgagcgga tctttacctc atgtgccatc tggcgcaccc caccacgatg atgcttgcag gtgaggaggt
gcatgaaacg gtcgacgcag tcctcaatgt catgctcaag atcgagcatc tcctcgttgt gcagccatgc aacagatgtg
cgtgcttcgc tcctgcccat agaaaggagc tggtcgtcca tgacggcggc aatcatgcgg aactcttgct ggagggagct
gatttcttgc tcgaggacct tgtgcttgtt gtactggttc tccagcacca tgaacagctt ccccatgatg gcctcccaga
aagcactcgc cgcagcagac tctatgGACA AGTATGGGCG TGTTTTGTTG CTTGCATGCG ACCTGGCTCA CACAAGAGAT
GCAGAGATAC TTTTGTGGAT CAGACAGACT GCTAGAGGGA GGAGCAGCAG CAGCTGCAAG CATGCAACCT CTAAGTCTTC
AGCAAGTCAA TAGCTCACCA TGCATATGTG TATATGCGTG GATACCCCCA ACTGAGTGCA AAATCATATT ACAATATCTT
TGTTGACAAG TATGTGTTTT TTTACACAAA CTGCTGATCA TTAAATGCCA TTTTAAATAT TCAGATAATC AGATCAGTAG
CTTTATATCG ATAAGGTACT TAAGAATCTT GTTCATAATA CAGGACATAT ATCTCTGAAA GGTTTTTGTT CATAAATTCA
TAACATATTT CACATTTCAG TACAAAATAA GCGCGCTTTT ATTGAGAAAG GATTTGTTTT AGTGTGTGCA AAAGCTTGTC
TACTAATCCC TTTACGTTTA GTGTAAAAGC CTGTTTACTA ATCGTTTTGC TCTTTGCCAT TCAGGTTTTT AGTTATTTAA
GATAGATATT TTTTGTCGAT AGTCCAGCGT ATCATGCATT TGTAAATCAT AAAATGTGCA AAACATAATA TGGGGCAGTG
TGTGTAAATT GTGAAACTTT GACAGATGAG TCTGCATTTT GAGACAAATG TAAATAATGT GAAGTTTGAG CATTGATATG
TAATTCTCAA TTTCAGGGAT ACTTGAGGAT TGGTGTGTAA AGCATATATC TTGAAAGGTG CTTCAGTGCT TGTCAAGTAG
TGATTATTGA AGTGTCCAAC AGCTACACCA CACAGTGGCC AATCGATCAT TTATTCTGAA GAAAATATTG TTGAATGGCT
GAATTGACCA GACGACCACT GTTGGCTGCA AACCGAAAGC TAATCCTCAA GGAGAGGAAA GCATTGGATT TGGAAGCTAG
GAATGAAGCA AAATGGAAGA ACTCTCTCCT AAGTCCAACC GCTTGGAGAG CTCGCTCATG CTACTCTGAT CATCTGATGC
CTTCAGCTTG TAGGTTCAGT AATCCCTCTC TTGTCTGTTT TAGTGATTCC ATTGTATTAT TTCCTTCTTT TTCAGCTCTT
TGTTTGCAGT CATTTAATGC CCCATGCCAT GCAAATCTGT AACATGCACT TGATTTGTTT ACAGAGAAGA TATCAATGGA
GGGCTCCATG TTCAACCTCC CAGGAAGGCT CGACCGGCTC CTGCGTCGTC ATGGCAGCAT GCTGCCCAAG GGGGCAGAGG
AGGAGATACC TCTCATCAAG CAAGATCTCG AGGAAATAAT CTCCGTCCTC CATGGTCACT GTAGCAAGCC AAAGCTGGAG
GACCATGCCA TGGTGGTCAG GTGctggatg aaggaggtac gtgagctctc ttatgacatc gaggattgca tcgaccagta
tgagcatgcc gccactgcca cccggTCACA TACTGGACCT AATATTTGTC GCCGTAAGTT CAATCAGCGG CATGGAAAGA
TGATCCCTTG GGTTCCCTGG AAACTTAAGC AGCGGTTGTG GATGGCCAAC AAGATCAGAG AATTCAGCCT GCGCACCCAG
GAGGCGCTTC AACGCCACAC CATGTACAAC AACCTTGGTG GCATCACCAT TGCTTCTACT ACTGGAGGAG ATGTATGCTC
TGCAACACCT TGGCATCCCA CGCAGTTCAG AGAGCACACC GACAACGTCT GTTCTGTCGG TATAGACGCC GATGGTATGG
AAGCTGCCCT GAATGACCTG AACAAGCTCA AAAACTTGCT CGCTAGTATC CCGACTGCTT CTCTCGTGCA GTTCAGGGAG
CACGCCAATA AAGTGCGTCA TATCCACCCC GATGTGGAAG CCATCCTGAA CAAGCTCAAA AACATACCCA CTGGTATCAC
CACTACTTCT ACTACCACTA GAGGTGATGT ATCTTCTACC TCATCTAGGC AACCCACGCG GTTCATGgag tccgcgggtc
ttgttggcat caacgccgcg gtgaacaagc ttgaaaactt gctcgatgtg tgcggagagg agaagctcaa ggtggtgtcc
atcgtgggag ttggaggagt tggcaagact acgctcgcca acaagctgta ctgcaagctt cagcggcagt tcgagtgctg
ggcatttgtg cagacatctc agaagactga tatgaggagg cttctcatca atatcctctc acaggttcag ccgcaccagt
cacctgacaa ttggaaggtg catagcctaa tttccagtat caggacacat ctgcaagata agaggtacGT ACAATGTTTT
CGGGGTGTGA AACTGACTAT TTCCTTGTTT TTGTTTGTGT CTGCTACTAA TTGTTAATCG GTGCATTTGA CTGTTGTACT
GATACTAATA TTATCTTCAT AAGTATAAAT ACAAATTTTT TAGTCAAGGA TTGAATGCAT GGGTTCAATA TTTCATTGAA
GTGGCAGATA GATAAGAAAG ACAGATACCA GCTCCTCTGA AGTCTATACT ACTAAATTAT ATGTAATGTA TAACATAACA
ATAGCAGGGT GTGTCTGTTG CTTGCTATCC CTGATATCAG CCTTAGCCAC AATTAGGGCT CAtttagcaa atgagattgg
gaaaagatat cccacccatc aaagggtaag gtttaatggt agccatccat tcctgtcacc ttattttatc ttaacaatcc
actcatttcc tattctaatc ctacctctta tatttcatCA TGTCTTCTAA TCATTTTTAG CCTCAAGATG GCTGTTATAA
GTTGCATAGT GTACAAAATC GAGAGAAAAA TCCGTCTTAC ACCTAATGTT TACCATTTCA TCATGCAAAT TCTAGCAGAA
TACTAACAAC AAGTGGAGCT TCCATTTAGT TATgttaaaa attctcccct taatcgcagg tacttgatca taattgatgg
tttatgggct acatccacat gggatgttat taagtgcgct ttgccggatg gtaatagttc cagcagaata ctaaccacaa
cagaaattga ggatctagct ttgcaatctt gtagttatga cttgaaattt attttcaaga tgaaaccttt tggtgagggt
gactcaagaa aactattttt cagtatagtc tttggctctc attctaagtg tcctccagaa gtcagtgaaa cattatatga
tattgtaagg aaatgtggtg gtttgccgct agctattgtc actgttgcta gtcttttagc aagccagctt gagaaacaag
aacaattgga ttatataaac aaatccttag gttacggttt gatggcaaat cctactttgg aagggatgaa acaactactg
aacatttgtt acaacaatct tcctcagcat ttgaaggtat gcatgttgta tcttagtatg tatcaagaag atcacataat
ttggaaagat gatttagtga gtcaatggat agctgaaggt tttatctgtg caactgaagg gcatgacaag gaagaaattt
caagggccta ttttgatgag cttgtgggca gaaaaatcat ccagccTGTA CATATCGATG ACAGTGGTGA GGTTTTGTCC
TGTGTAGTTC ACCATATGGT ACTCAATTTC GTTACATACA AGTCAATAGA AGAAAATTTT ATTATTGCAA TAGACCATTC
ACAGGCAACT ATAAGATTTG CTGACAAGGT TCGACGATTA TCTATCCACT TTAGTAACGT AGAAGATGCA ACTCCGCCTA
CCAGTATGAG ATTGTCCCAA GTTCGGACAG TTGCCTTCTT CGGGGTCTTG AAGTATATGC CTTTCGTTAT GGAGTTTCGA
CTTATTAAAG TTCTAGTTCT ACATATTTTG GGTGATGAGG ATAGCATCGG CATTTTTGAT CTCACTAAAA TTTCAGAACT
TGTTCGACTG AGATATTTGA AGGTCACCTC TAATGTCACC GTAAAACTGC CAACCCAGAT GCAAGGTCTA CCATATTTGG
AGACACTGAA AATAGATGGG ACAATAAGTG AAGTTCCAAC AGACATTTAT TTGCCACGTT TGCTGCATCT TACTCTTCCT
GCTAAGACAA ACCTGCCCAG TGGAATTGTC CACATGACAT CGCTTCGTAC AATTGGATAT TTTGATCTCA GCTGTAACTC
AGCGGAGAAT CTATGGAGCC TTGGTGAGCT GAGCAATCTC CGGGATTTGC AGCTCACCTA TTCTGAAATA CATTCTGACA
ATCTGAAGGA TAATATGAAA TATCTTGGAT CCATTCTGGG GAAACTCCGT AATCTCACAT CTATAACTTT ATCGCCTCCT
GGCTCTTCCT GTCCAGATAC TCTACATATT GACAGGACGA GGATCAATGT TGATGGCTGG AGCAGTGTGT CCTCTCCACC
AGCCCTTCTT CAGAGGTTTG AGTTGTTACC ATGTGTTTGC ATCTTTTCTA ACCTCCCAAA TTGGATTGGG CAGCTTGGAA
ACCTCTGCAT TTTGAAGATT GGGATAAGGG AAGTAACAAG TAATAGTATT GATGTTCTAG GAGTATTACC GAAACTCACT
GTTTTGTCAC TTTATGTCCA CACAAAGCCT GCAGAAAGGA TTGTCTTTGA CAATGCAGGG TTCTCAATCC TCAAATACTT
CGAGTTTATA TGCAGTGTAG CATGGATGAA ATTTGAGATG GGTGCAATGC CTAGTCTAAG GAAGCTCAAG CTAGGTTTTG
ATGTCCATAT AGCAGATCAG CATGATATTA TTCCTGTTGG CATCGAACAT CTGTCTGGAC TTGAAGAGAT CTCTGCAAAA
ATTAGGGTCG CCTGTACTGC TCATGATCAT TGTAGAAGAT TTGCAGAGTC AGCTTTGACT AACGCCTTTA TGATGCATCC
AGGACGTCCT AGCGTCAACA TACGGTGTGT GGATTGGACC TTTCATGATA AGGATAATGA CTGTGTGGGG ACACGAGAGG
AAGAATGTAG GACTCCAATG AAACAGGAGC ATTTTGTGAA AGAAGACTTA AGTGAGAAAT CTGCAGTTCT ACAAAACGAG
CACGACGAAG AAGCACATAA ATTTGTTGAC AGAAGGTATG AATTTGTCAC ACTAAGAATT CAGCATTGCC AATTTACTAG
GACCAACACC CTTTTTTTAG AAAAATGGAT ATTTCATTAA ACAATAAAAT CATCACGTTG TATTGTGGCA GCGCTTACCC
TCCTACGATC CTCCGACCAG AACACAACAC TTCTTATCAT TACTCTCGTT GACTCAGAAC ATAAAGACAT GTAGTAAAAT
TCCATTAGAT ATTTAGATAT GCACATATAT ACGTCCAAAG ATGTTATGGT CGGGATTGCA TATCACCGAC GCCGCAAGAA
GCCAGGCGCG CACGACGCTG GGAGCGCGGC TGCCGTGGCA TCGCCCTGAA GAATTGCTTG CAGGTCGCGC TACAGTGTCC
GTGGGTTGGA TTGGGTTTGT TAGGATttgg ttcagagttt gtttagtggt tttatccctt ctttctagca tttgttagcc
attggaaCGG GATACCCTTC TACGAGACAa tacctaatac ctgatacctg ttgtggtacc agttatatgc tacccgatac
ctgtgatgca tgttacctgg tacctatgat acctaaaacc tgatacctgt gatacTCGTA CAAGAGAATA GTTAATATGT
CTATCCCGTT GTAATGGGAT CCTGTTTTGT AGCAGCCCTC TTGttagttt catctataag ctcatttaag gagcaattcg
agtgataatg aattaagtca gttcagccta ttcttctcat ctacgtttct ctgtttttct catcctcttc tgttcgtccc
cgccggcgcc acgggtcgct ggtctaccaa gcctccgaag ccccgacctc ctaccacaca ctcatatcct attaggtcaa
tccctggagc tcgtgacaaA AGAGCAAAGT CCAAATTTTC ATACACGCAG ATACAGATAA TATTTTAAAT TCGGCCAATC
CAATTTGTCT TCCGTTGCAA TGCATGAGCT CTTGGCATAG TAACTAGCAT ATGTAAGGAG TAGTTTGTAC TTTGTAAGTT
TCATGTAAAT AAAAGGAAAA GCTAATTAGA AGAAGAAAAC ATTTTTTATT TTTATACGAG ACCTAAGTTA TATATACGGA
AAACCAGTTT TGCGGACGAG ACACTTCCAT TTTTCCAAAC GGGTATTTCT TTTGGAACCA CACATCCACG TGATTTCAAA
GAAAAAAAAT TGTACAGATA TATAGCAAAA ATCGTCCCAT TTTATAGCTA ggataatttt accattattg agaaggtact
gagagatact atattttata atgtaaaatt tgatatatct aggtaccagt acatcgagat actaaaattt tagtgtaaaa
tcttgatatc tccatgtact ttcgtaagga ttataCTTGT AGCTAACTTG GTGGACATGC ACCGATCGAA TTACTATTTC
TTTTTGTACA GATATTATCC CATCATGGAC GCGGCAGAGA TCCGCAGGTG TCCGTGGAGC GTCAACGAGG AGCAGGAGCA
GCCGGTGTTG ATCTACGACG CCAGAACCAA GATCTCCCAG TCGTCGTCCA TGCACAGCGA ATTCTGGGCG GCCGTCCAAC
GGCTCACCGG CCCAGCTGCC ACGCCGGCCA AGACCAAGAG GCACCTCCAC CTGACGACCT CGCCTGAGCT GGAGGACGGC
TTCTTGCCGG TACGTAGTCT CGTCTTCCCG TCCGCTCCGG ATCCACGGTG CAACATGAAG AAGAAGAAGA TGagggccgg
ccctggaggg ggtcgagcag tgcggtcaaa ctgggccccc aaatcgtagg ggccccaACC CAGGGAGCCT GCAAAGCCTC
TCTTCTGCAA CAAAGCCATG CGATGAGATG ATGCGAACAG AAACGCCCAA TTCCTACTGC AAAGCCTCTC AGTGCCTTGC
CGCCTGCCGA GTTGCCGTCG ACCGCCCCGG CGCCGCCGTT GGCTGCTGCT GCAAGCCTGA AGACAGCTGC AACTGCTGAT
TTGCTAAACT GCGCACCTCA GCCTAACGAT CAAAACTAAA AGTCTCAAGA GGTGTTGATG ATGCGAAGTG ATCAGGTGAG
CAGCAGCATG CCAGCAACAC CGTCGCCATC GCCAATTGAG ATTTGTTTTA ATTCTATGAT TTTATCTGTT GGTTGTTGGT
CTATTGCCAT CATGCCATGT ACTGATGAAC AGACGTATAT ATACATGCAC TACTATGTTC CATGTTAGGT TAATAGGTTT
GTGACTTACT GACTTTGTGT CTGTCTCTTA TTTTTTTAGT TGTTTAAAAG ATCTGAGTTC AGAGGGATTG AGCTTGGAGA
CGTGCTAGTG TGTGATGAGT CGTGCGCATC CGGACGTCTG TGAATATTTA ATTGGTAAGA CTTTAAATTT GAATTTGTAG
TTTTATGGTG T

Locus: Os11g0684100

Loading...

Locus: Os11g0684100

Loading...