Os11t0684100-02

Locus

Os11g0684100

Description

NB-ARC domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY125

CGSNL Gene Name

WRKY GENE 125

Oryzabase Gene Symbol Synonym(s)

OsWRKY125

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK066053 (DDBJ, Best hit)

Protein Evidence

Q6IEP0 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: defense response (GO:0006952)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

Disease resistance protein (IPR000767)

NB-ARC (IPR002182)

Full-length cDNA

J013052I15 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0684100-02)

RiceXPro (AK066053)

Others

Oryzabase (9227)

KEGG (Os11t0684100-02)

Transcript

4259 bp

>Os11t0684100-02 NB-ARC domain containing protein.
ATTGGATTTGGAAGCTAGGAATGAAGCAAAATGGAAGAACTCTCTCCTAAGTCCAACCGC
TTGGAGAGCTCGCTCATGCTACTCTGATCATCTGATGCCTTCAGCTTAGAAGATATCAAT
GGAGGGCTCCATGTTCAACCTCCCAGGAAGGCTCGACCGGCTCCTGCGTCGTCATGGCAG
CATGCTGCCCAAGGGGGCAGAGGAGGAGATACCTCTCATCAAGCAAGATCTCGAGGAAAT
AATCTCCGTCCTCCATGGTCACTGTAGCAAGCCAAAGCTGGAGGACCATGCCATGGTGGT
CAGGTGctggatgaaggaggtacgtgagctctcttatgacatcgaggattgcatcgacca
gtatgagcatgccgccactgccacccggTCACATACTGGACCTAATATTTGTCGCCGTAA
GTTCAATCAGCGGCATGGAAAGATGATCCCTTGGGTTCCCTGGAAACTTAAGCAGCGGTT
GTGGATGGCCAACAAGATCAGAGAATTCAGCCTGCGCACCCAGGAGGCGCTTCAACGCCA
CACCATGTACAACAACCTTGGTGGCATCACCATTGCTTCTACTACTGGAGGAGATGTATG
CTCTGCAACACCTTGGCATCCCACGCAGTTCAGAGAGCACACCGACAACGTCTGTTCTGT
CGGTATAGACGCCGATGGTATGGAAGCTGCCCTGAATGACCTGAACAAGCTCAAAAACTT
GCTCGCTAGTATCCCGACTGCTTCTCTCGTGCAGTTCAGGGAGCACGCCAATAAAGTGCG
TCATATCCACCCCGATGTGGAAGCCATCCTGAACAAGCTCAAAAACATACCCACTGGTAT
CACCACTACTTCTACTACCACTAGAGGTGATGTATCTTCTACCTCATCTAGGCAACCCAC
GCGGTTCATGgagtccgcgggtcttgttggcatcaacgccgcggtgaacaagcttgaaaa
cttgctcgatgtgtgcggagaggagaagctcaaggtggtgtccatcgtgggagttggagg
agttggcaagactacgctcgccaacaagctgtactgcaagcttcagcggcagttcgagtg
ctgggcatttgtgcagacatctcagaagactgatatgaggaggcttctcatcaatatcct
ctcacaggttcagccgcaccagtcacctgacaattggaaggtgcatagcctaatttccag
tatcaggacacatctgcaagataagaggtacttgatcataattgatggtttatgggctac
atccacatgggatgttattaagtgcgctttgccggatggtaatagttccagcagaatact
aaccacaacagaaattgaggatctagctttgcaatcttgtagttatgacttgaaatttat
tttcaagatgaaaccttttggtgagggtgactcaagaaaactatttttcagtatagtctt
tggctctcattctaagtgtcctccagaagtcagtgaaacattatatgatattgtaaggaa
atgtggtggtttgccgctagctattgtcactgttgctagtcttttagcaagccagcttga
gaaacaagaacaattggattatataaacaaatccttaggttacggtttgatggcaaatcc
tactttggaagggatgaaacaactactgaacatttgttacaacaatcttcctcagcattt
gaaggtatgcatgttgtatcttagtatgtatcaagaagatcacataatttggaaagatga
tttagtgagtcaatggatagctgaaggttttatctgtgcaactgaagggcatgacaagga
agaaatttcaagggcctattttgatgagcttgtgggcagaaaaatcatccagccTGTACA
TATCGATGACAGTGGTGAGGTTTTGTCCTGTGTAGTTCACCATATGGTACTCAATTTCGT
TACATACAAGTCAATAGAAGAAAATTTTATTATTGCAATAGACCATTCACAGGCAACTAT
AAGATTTGCTGACAAGGTTCGACGATTATCTATCCACTTTAGTAACGTAGAAGATGCAAC
TCCGCCTACCAGTATGAGATTGTCCCAAGTTCGGACAGTTGCCTTCTTCGGGGTCTTGAA
GTATATGCCTTTCGTTATGGAGTTTCGACTTATTAAAGTTCTAGTTCTACATATTTTGGG
TGATGAGGATAGCATCGGCATTTTTGATCTCACTAAAATTTCAGAACTTGTTCGACTGAG
ATATTTGAAGGTCACCTCTAATGTCACCGTAAAACTGCCAACCCAGATGCAAGGTCTACC
ATATTTGGAGACACTGAAAATAGATGGGACAATAAGTGAAGTTCCAACAGACATTTATTT
GCCACGTTTGCTGCATCTTACTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATTGTCCA
CATGACATCGCTTCGTACAATTGGATATTTTGATCTCAGCTGTAACTCAGCGGAGAATCT
ATGGAGCCTTGGTGAGCTGAGCAATCTCCGGGATTTGCAGCTCACCTATTCTGAAATACA
TTCTGACAATCTGAAGGATAATATGAAATATCTTGGATCCATTCTGGGGAAACTCCGTAA
TCTCACATCTATAACTTTATCGCCTCCTGGCTCTTCCTGTCCAGATACTCTACATATTGA
CAGGACGAGGATCAATGTTGATGGCTGGAGCAGTGTGTCCTCTCCACCAGCCCTTCTTCA
GAGGTTTGAGTTGTTACCATGTGTTTGCATCTTTTCTAACCTCCCAAATTGGATTGGGCA
GCTTGGAAACCTCTGCATTTTGAAGATTGGGATAAGGGAAGTAACAAGTAATAGTATTGA
TGTTCTAGGAGTATTACCGAAACTCACTGTTTTGTCACTTTATGTCCACACAAAGCCTGC
AGAAAGGATTGTCTTTGACAATGCAGGGTTCTCAATCCTCAAATACTTCGAGTTTATATG
CAGTGTAGCATGGATGAAATTTGAGATGGGTGCAATGCCTAGTCTAAGGAAGCTCAAGCT
AGGTTTTGATGTCCATATAGCAGATCAGCATGATATTATTCCTGTTGGCATCGAACATCT
GTCTGGACTTGAAGAGATCTCTGCAAAAATTAGGGTCGCCTGTACTGCTCATGATCATTG
TAGAAGATTTGCAGAGTCAGCTTTGACTAACGCCTTTATGATGCATCCAGGACGTCCTAG
CGTCAACATACGGTGTGTGGATTGGACCTTTCATGATAAGGATAATGACTGTGTGGGGAC
ACGAGAGGAAGAATGTAGGACTCCAATGAAACAGGAGCATTTTGTGAAAGAAGACTTAAG
TGAGAAATCTGCAGTTCTACAAAACGAGCACGACGAAGAAGCACATAAATTTGTTGACAG
AAGATATTATCCCATCATGGACGCGGCAGAGATCCGCAGGTGTCCGTGGAGCGTCAACGA
GGAGCAGGAGCAGCCGGTGTTGATCTACGACGCCAGAACCAAGATCTCCCAGTCGTCGTC
CATGCACAGCGAATTCTGGGCGGCCGTCCAACGGCTCACCGGCCCAGCTGCCACGCCGGC
CAAGACCAAGAGGCACCTCCACCTGACGACCTCGCCTGAGCTGGAGGACGGCTTCTTGCC
GGTACGTAGTCTCGTCTTCCCGTCCGCTCCGGATCCACGGTGCAACATGAAGAAGAAGAA
GATGagggccggccctggagggggtcgagcagtgcggtcaaactgggcccccaaatcgta
ggggccccaACCCAGGGAGCCTGCAAAGCCTCTCTTCTGCAACAAAGCCATGCGATGAGA
TGATGCGAACAGAAACGCCCAATTCCTACTGCAAAGCCTCTCAGTGCCTTGCCGCCTGCC
GAGTTGCCGTCGACCGCCCCGGCGCCGCCGTTGGCTGCTGCTGCAAGCCTGAAGACAGCT
GCAACTGCTGATTTGCTAAACTGCGCACCTCAGCCTAACGATCAAAACTAAAAGTCTCAA
GAGGTGTTGATGATGCGAAGTGATCAGTTGTTTAAAAGATCTGAGTTCAGAGGGATTGAG
CTTGGAGACGTGCTAGTGTGTGATGAGTCGTGCGCATCCGGACGTCTGTGAATATTTAAT
TGGTAAGACTTTAAATTTGAATTTGTAGTTTTATGGTGTAATTTATATGAGTATCTCCAT
AAGTAATgtttttctttctagtacccgtcactgtggcatattttgaaagaagctttttga
agtcgaaattattaaagaaactattgagatctaaaatgtcgaagaaAGTGTttgatgcg

CDS

3603 bp

>Os11t0684100-02 NB-ARC domain containing protein.
ATGGAGGGCTCCATGTTCAACCTCCCAGGAAGGCTCGACCGGCTCCTGCGTCGTCATGGC
AGCATGCTGCCCAAGGGGGCAGAGGAGGAGATACCTCTCATCAAGCAAGATCTCGAGGAA
ATAATCTCCGTCCTCCATGGTCACTGTAGCAAGCCAAAGCTGGAGGACCATGCCATGGTG
GTCAGGTGctggatgaaggaggtacgtgagctctcttatgacatcgaggattgcatcgac
cagtatgagcatgccgccactgccacccggTCACATACTGGACCTAATATTTGTCGCCGT
AAGTTCAATCAGCGGCATGGAAAGATGATCCCTTGGGTTCCCTGGAAACTTAAGCAGCGG
TTGTGGATGGCCAACAAGATCAGAGAATTCAGCCTGCGCACCCAGGAGGCGCTTCAACGC
CACACCATGTACAACAACCTTGGTGGCATCACCATTGCTTCTACTACTGGAGGAGATGTA
TGCTCTGCAACACCTTGGCATCCCACGCAGTTCAGAGAGCACACCGACAACGTCTGTTCT
GTCGGTATAGACGCCGATGGTATGGAAGCTGCCCTGAATGACCTGAACAAGCTCAAAAAC
TTGCTCGCTAGTATCCCGACTGCTTCTCTCGTGCAGTTCAGGGAGCACGCCAATAAAGTG
CGTCATATCCACCCCGATGTGGAAGCCATCCTGAACAAGCTCAAAAACATACCCACTGGT
ATCACCACTACTTCTACTACCACTAGAGGTGATGTATCTTCTACCTCATCTAGGCAACCC
ACGCGGTTCATGgagtccgcgggtcttgttggcatcaacgccgcggtgaacaagcttgaa
aacttgctcgatgtgtgcggagaggagaagctcaaggtggtgtccatcgtgggagttgga
ggagttggcaagactacgctcgccaacaagctgtactgcaagcttcagcggcagttcgag
tgctgggcatttgtgcagacatctcagaagactgatatgaggaggcttctcatcaatatc
ctctcacaggttcagccgcaccagtcacctgacaattggaaggtgcatagcctaatttcc
agtatcaggacacatctgcaagataagaggtacttgatcataattgatggtttatgggct
acatccacatgggatgttattaagtgcgctttgccggatggtaatagttccagcagaata
ctaaccacaacagaaattgaggatctagctttgcaatcttgtagttatgacttgaaattt
attttcaagatgaaaccttttggtgagggtgactcaagaaaactatttttcagtatagtc
tttggctctcattctaagtgtcctccagaagtcagtgaaacattatatgatattgtaagg
aaatgtggtggtttgccgctagctattgtcactgttgctagtcttttagcaagccagctt
gagaaacaagaacaattggattatataaacaaatccttaggttacggtttgatggcaaat
cctactttggaagggatgaaacaactactgaacatttgttacaacaatcttcctcagcat
ttgaaggtatgcatgttgtatcttagtatgtatcaagaagatcacataatttggaaagat
gatttagtgagtcaatggatagctgaaggttttatctgtgcaactgaagggcatgacaag
gaagaaatttcaagggcctattttgatgagcttgtgggcagaaaaatcatccagccTGTA
CATATCGATGACAGTGGTGAGGTTTTGTCCTGTGTAGTTCACCATATGGTACTCAATTTC
GTTACATACAAGTCAATAGAAGAAAATTTTATTATTGCAATAGACCATTCACAGGCAACT
ATAAGATTTGCTGACAAGGTTCGACGATTATCTATCCACTTTAGTAACGTAGAAGATGCA
ACTCCGCCTACCAGTATGAGATTGTCCCAAGTTCGGACAGTTGCCTTCTTCGGGGTCTTG
AAGTATATGCCTTTCGTTATGGAGTTTCGACTTATTAAAGTTCTAGTTCTACATATTTTG
GGTGATGAGGATAGCATCGGCATTTTTGATCTCACTAAAATTTCAGAACTTGTTCGACTG
AGATATTTGAAGGTCACCTCTAATGTCACCGTAAAACTGCCAACCCAGATGCAAGGTCTA
CCATATTTGGAGACACTGAAAATAGATGGGACAATAAGTGAAGTTCCAACAGACATTTAT
TTGCCACGTTTGCTGCATCTTACTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATTGTC
CACATGACATCGCTTCGTACAATTGGATATTTTGATCTCAGCTGTAACTCAGCGGAGAAT
CTATGGAGCCTTGGTGAGCTGAGCAATCTCCGGGATTTGCAGCTCACCTATTCTGAAATA
CATTCTGACAATCTGAAGGATAATATGAAATATCTTGGATCCATTCTGGGGAAACTCCGT
AATCTCACATCTATAACTTTATCGCCTCCTGGCTCTTCCTGTCCAGATACTCTACATATT
GACAGGACGAGGATCAATGTTGATGGCTGGAGCAGTGTGTCCTCTCCACCAGCCCTTCTT
CAGAGGTTTGAGTTGTTACCATGTGTTTGCATCTTTTCTAACCTCCCAAATTGGATTGGG
CAGCTTGGAAACCTCTGCATTTTGAAGATTGGGATAAGGGAAGTAACAAGTAATAGTATT
GATGTTCTAGGAGTATTACCGAAACTCACTGTTTTGTCACTTTATGTCCACACAAAGCCT
GCAGAAAGGATTGTCTTTGACAATGCAGGGTTCTCAATCCTCAAATACTTCGAGTTTATA
TGCAGTGTAGCATGGATGAAATTTGAGATGGGTGCAATGCCTAGTCTAAGGAAGCTCAAG
CTAGGTTTTGATGTCCATATAGCAGATCAGCATGATATTATTCCTGTTGGCATCGAACAT
CTGTCTGGACTTGAAGAGATCTCTGCAAAAATTAGGGTCGCCTGTACTGCTCATGATCAT
TGTAGAAGATTTGCAGAGTCAGCTTTGACTAACGCCTTTATGATGCATCCAGGACGTCCT
AGCGTCAACATACGGTGTGTGGATTGGACCTTTCATGATAAGGATAATGACTGTGTGGGG
ACACGAGAGGAAGAATGTAGGACTCCAATGAAACAGGAGCATTTTGTGAAAGAAGACTTA
AGTGAGAAATCTGCAGTTCTACAAAACGAGCACGACGAAGAAGCACATAAATTTGTTGAC
AGAAGATATTATCCCATCATGGACGCGGCAGAGATCCGCAGGTGTCCGTGGAGCGTCAAC
GAGGAGCAGGAGCAGCCGGTGTTGATCTACGACGCCAGAACCAAGATCTCCCAGTCGTCG
TCCATGCACAGCGAATTCTGGGCGGCCGTCCAACGGCTCACCGGCCCAGCTGCCACGCCG
GCCAAGACCAAGAGGCACCTCCACCTGACGACCTCGCCTGAGCTGGAGGACGGCTTCTTG
CCGGTACGTAGTCTCGTCTTCCCGTCCGCTCCGGATCCACGGTGCAACATGAAGAAGAAG
AAGATGagggccggccctggagggggtcgagcagtgcggtcaaactgggcccccaaatcg
tag

Protein

1201 aa

>Os11t0684100-02 NB-ARC domain containing protein.
MEGSMFNLPGRLDRLLRRHGSMLPKGAEEEIPLIKQDLEEIISVLHGHCSKPKLEDHAMV
VRCWMKEVRELSYDIEDCIDQYEHAATATRSHTGPNICRRKFNQRHGKMIPWVPWKLKQR
LWMANKIREFSLRTQEALQRHTMYNNLGGITIASTTGGDVCSATPWHPTQFREHTDNVCS
VGIDADGMEAALNDLNKLKNLLASIPTASLVQFREHANKVRHIHPDVEAILNKLKNIPTG
ITTTSTTTRGDVSSTSSRQPTRFMESAGLVGINAAVNKLENLLDVCGEEKLKVVSIVGVG
GVGKTTLANKLYCKLQRQFECWAFVQTSQKTDMRRLLINILSQVQPHQSPDNWKVHSLIS
SIRTHLQDKRYLIIIDGLWATSTWDVIKCALPDGNSSSRILTTTEIEDLALQSCSYDLKF
IFKMKPFGEGDSRKLFFSIVFGSHSKCPPEVSETLYDIVRKCGGLPLAIVTVASLLASQL
EKQEQLDYINKSLGYGLMANPTLEGMKQLLNICYNNLPQHLKVCMLYLSMYQEDHIIWKD
DLVSQWIAEGFICATEGHDKEEISRAYFDELVGRKIIQPVHIDDSGEVLSCVVHHMVLNF
VTYKSIEENFIIAIDHSQATIRFADKVRRLSIHFSNVEDATPPTSMRLSQVRTVAFFGVL
KYMPFVMEFRLIKVLVLHILGDEDSIGIFDLTKISELVRLRYLKVTSNVTVKLPTQMQGL
PYLETLKIDGTISEVPTDIYLPRLLHLTLPAKTNLPSGIVHMTSLRTIGYFDLSCNSAEN
LWSLGELSNLRDLQLTYSEIHSDNLKDNMKYLGSILGKLRNLTSITLSPPGSSCPDTLHI
DRTRINVDGWSSVSSPPALLQRFELLPCVCIFSNLPNWIGQLGNLCILKIGIREVTSNSI
DVLGVLPKLTVLSLYVHTKPAERIVFDNAGFSILKYFEFICSVAWMKFEMGAMPSLRKLK
LGFDVHIADQHDIIPVGIEHLSGLEEISAKIRVACTAHDHCRRFAESALTNAFMMHPGRP
SVNIRCVDWTFHDKDNDCVGTREEECRTPMKQEHFVKEDLSEKSAVLQNEHDEEAHKFVD
RRYYPIMDAAEIRRCPWSVNEEQEQPVLIYDARTKISQSSSMHSEFWAAVQRLTGPAATP
AKTKRHLHLTTSPELEDGFLPVRSLVFPSAPDPRCNMKKKKMRAGPGGGRAVRSNWAPKS
*

5'UTR

chr11:27690182..27690288 (- strand) : 107 bp

chr11:27690036..27690046 (- strand) : 11 bp

CDS

chr11:27688927..27690035 (- strand) : 1109 bp

chr11:27686156..27688291 (- strand) : 2136 bp

chr11:27684382..27684739 (- strand) : 358 bp

3'UTR

chr11:27684116..27684381 (- strand) : 266 bp

chr11:27683640..27683911 (- strand) : 272 bp

FASTA

>Os11t0684100-02 class=Sequence position=chr11:27683640..27690288 (- strand)
ATTGGATTTG GAAGCTAGGA ATGAAGCAAA ATGGAAGAAC TCTCTCCTAA GTCCAACCGC TTGGAGAGCT CGCTCATGCT
ACTCTGATCA TCTGATGCCT TCAGCTTGTA GGTTCAGTAA TCCCTCTCTT GTCTGTTTTA GTGATTCCAT TGTATTATTT
CCTTCTTTTT CAGCTCTTTG TTTGCAGTCA TTTAATGCCC CATGCCATGC AAATCTGTAA CATGCACTTG ATTTGTTTAC
AGAGAAGATA TCAATGGAGG GCTCCATGTT CAACCTCCCA GGAAGGCTCG ACCGGCTCCT GCGTCGTCAT GGCAGCATGC
TGCCCAAGGG GGCAGAGGAG GAGATACCTC TCATCAAGCA AGATCTCGAG GAAATAATCT CCGTCCTCCA TGGTCACTGT
AGCAAGCCAA AGCTGGAGGA CCATGCCATG GTGGTCAGGT Gctggatgaa ggaggtacgt gagctctctt atgacatcga
ggattgcatc gaccagtatg agcatgccgc cactgccacc cggTCACATA CTGGACCTAA TATTTGTCGC CGTAAGTTCA
ATCAGCGGCA TGGAAAGATG ATCCCTTGGG TTCCCTGGAA ACTTAAGCAG CGGTTGTGGA TGGCCAACAA GATCAGAGAA
TTCAGCCTGC GCACCCAGGA GGCGCTTCAA CGCCACACCA TGTACAACAA CCTTGGTGGC ATCACCATTG CTTCTACTAC
TGGAGGAGAT GTATGCTCTG CAACACCTTG GCATCCCACG CAGTTCAGAG AGCACACCGA CAACGTCTGT TCTGTCGGTA
TAGACGCCGA TGGTATGGAA GCTGCCCTGA ATGACCTGAA CAAGCTCAAA AACTTGCTCG CTAGTATCCC GACTGCTTCT
CTCGTGCAGT TCAGGGAGCA CGCCAATAAA GTGCGTCATA TCCACCCCGA TGTGGAAGCC ATCCTGAACA AGCTCAAAAA
CATACCCACT GGTATCACCA CTACTTCTAC TACCACTAGA GGTGATGTAT CTTCTACCTC ATCTAGGCAA CCCACGCGGT
TCATGgagtc cgcgggtctt gttggcatca acgccgcggt gaacaagctt gaaaacttgc tcgatgtgtg cggagaggag
aagctcaagg tggtgtccat cgtgggagtt ggaggagttg gcaagactac gctcgccaac aagctgtact gcaagcttca
gcggcagttc gagtgctggg catttgtgca gacatctcag aagactgata tgaggaggct tctcatcaat atcctctcac
aggttcagcc gcaccagtca cctgacaatt ggaaggtgca tagcctaatt tccagtatca ggacacatct gcaagataag
aggtacGTAC AATGTTTTCG GGGTGTGAAA CTGACTATTT CCTTGTTTTT GTTTGTGTCT GCTACTAATT GTTAATCGGT
GCATTTGACT GTTGTACTGA TACTAATATT ATCTTCATAA GTATAAATAC AAATTTTTTA GTCAAGGATT GAATGCATGG
GTTCAATATT TCATTGAAGT GGCAGATAGA TAAGAAAGAC AGATACCAGC TCCTCTGAAG TCTATACTAC TAAATTATAT
GTAATGTATA ACATAACAAT AGCAGGGTGT GTCTGTTGCT TGCTATCCCT GATATCAGCC TTAGCCACAA TTAGGGCTCA
tttagcaaat gagattggga aaagatatcc cacccatcaa agggtaaggt ttaatggtag ccatccattc ctgtcacctt
attttatctt aacaatccac tcatttccta ttctaatcct acctcttata tttcatCATG TCTTCTAATC ATTTTTAGCC
TCAAGATGGC TGTTATAAGT TGCATAGTGT ACAAAATCGA GAGAAAAATC CGTCTTACAC CTAATGTTTA CCATTTCATC
ATGCAAATTC TAGCAGAATA CTAACAACAA GTGGAGCTTC CATTTAGTTA Tgttaaaaat tctcccctta atcgcaggta
cttgatcata attgatggtt tatgggctac atccacatgg gatgttatta agtgcgcttt gccggatggt aatagttcca
gcagaatact aaccacaaca gaaattgagg atctagcttt gcaatcttgt agttatgact tgaaatttat tttcaagatg
aaaccttttg gtgagggtga ctcaagaaaa ctatttttca gtatagtctt tggctctcat tctaagtgtc ctccagaagt
cagtgaaaca ttatatgata ttgtaaggaa atgtggtggt ttgccgctag ctattgtcac tgttgctagt cttttagcaa
gccagcttga gaaacaagaa caattggatt atataaacaa atccttaggt tacggtttga tggcaaatcc tactttggaa
gggatgaaac aactactgaa catttgttac aacaatcttc ctcagcattt gaaggtatgc atgttgtatc ttagtatgta
tcaagaagat cacataattt ggaaagatga tttagtgagt caatggatag ctgaaggttt tatctgtgca actgaagggc
atgacaagga agaaatttca agggcctatt ttgatgagct tgtgggcaga aaaatcatcc agccTGTACA TATCGATGAC
AGTGGTGAGG TTTTGTCCTG TGTAGTTCAC CATATGGTAC TCAATTTCGT TACATACAAG TCAATAGAAG AAAATTTTAT
TATTGCAATA GACCATTCAC AGGCAACTAT AAGATTTGCT GACAAGGTTC GACGATTATC TATCCACTTT AGTAACGTAG
AAGATGCAAC TCCGCCTACC AGTATGAGAT TGTCCCAAGT TCGGACAGTT GCCTTCTTCG GGGTCTTGAA GTATATGCCT
TTCGTTATGG AGTTTCGACT TATTAAAGTT CTAGTTCTAC ATATTTTGGG TGATGAGGAT AGCATCGGCA TTTTTGATCT
CACTAAAATT TCAGAACTTG TTCGACTGAG ATATTTGAAG GTCACCTCTA ATGTCACCGT AAAACTGCCA ACCCAGATGC
AAGGTCTACC ATATTTGGAG ACACTGAAAA TAGATGGGAC AATAAGTGAA GTTCCAACAG ACATTTATTT GCCACGTTTG
CTGCATCTTA CTCTTCCTGC TAAGACAAAC CTGCCCAGTG GAATTGTCCA CATGACATCG CTTCGTACAA TTGGATATTT
TGATCTCAGC TGTAACTCAG CGGAGAATCT ATGGAGCCTT GGTGAGCTGA GCAATCTCCG GGATTTGCAG CTCACCTATT
CTGAAATACA TTCTGACAAT CTGAAGGATA ATATGAAATA TCTTGGATCC ATTCTGGGGA AACTCCGTAA TCTCACATCT
ATAACTTTAT CGCCTCCTGG CTCTTCCTGT CCAGATACTC TACATATTGA CAGGACGAGG ATCAATGTTG ATGGCTGGAG
CAGTGTGTCC TCTCCACCAG CCCTTCTTCA GAGGTTTGAG TTGTTACCAT GTGTTTGCAT CTTTTCTAAC CTCCCAAATT
GGATTGGGCA GCTTGGAAAC CTCTGCATTT TGAAGATTGG GATAAGGGAA GTAACAAGTA ATAGTATTGA TGTTCTAGGA
GTATTACCGA AACTCACTGT TTTGTCACTT TATGTCCACA CAAAGCCTGC AGAAAGGATT GTCTTTGACA ATGCAGGGTT
CTCAATCCTC AAATACTTCG AGTTTATATG CAGTGTAGCA TGGATGAAAT TTGAGATGGG TGCAATGCCT AGTCTAAGGA
AGCTCAAGCT AGGTTTTGAT GTCCATATAG CAGATCAGCA TGATATTATT CCTGTTGGCA TCGAACATCT GTCTGGACTT
GAAGAGATCT CTGCAAAAAT TAGGGTCGCC TGTACTGCTC ATGATCATTG TAGAAGATTT GCAGAGTCAG CTTTGACTAA
CGCCTTTATG ATGCATCCAG GACGTCCTAG CGTCAACATA CGGTGTGTGG ATTGGACCTT TCATGATAAG GATAATGACT
GTGTGGGGAC ACGAGAGGAA GAATGTAGGA CTCCAATGAA ACAGGAGCAT TTTGTGAAAG AAGACTTAAG TGAGAAATCT
GCAGTTCTAC AAAACGAGCA CGACGAAGAA GCACATAAAT TTGTTGACAG AAGGTATGAA TTTGTCACAC TAAGAATTCA
GCATTGCCAA TTTACTAGGA CCAACACCCT TTTTTTAGAA AAATGGATAT TTCATTAAAC AATAAAATCA TCACGTTGTA
TTGTGGCAGC GCTTACCCTC CTACGATCCT CCGACCAGAA CACAACACTT CTTATCATTA CTCTCGTTGA CTCAGAACAT
AAAGACATGT AGTAAAATTC CATTAGATAT TTAGATATGC ACATATATAC GTCCAAAGAT GTTATGGTCG GGATTGCATA
TCACCGACGC CGCAAGAAGC CAGGCGCGCA CGACGCTGGG AGCGCGGCTG CCGTGGCATC GCCCTGAAGA ATTGCTTGCA
GGTCGCGCTA CAGTGTCCGT GGGTTGGATT GGGTTTGTTA GGATttggtt cagagtttgt ttagtggttt tatcccttct
ttctagcatt tgttagccat tggaaCGGGA TACCCTTCTA CGAGACAata cctaatacct gatacctgtt gtggtaccag
ttatatgcta cccgatacct gtgatgcatg ttacctggta cctatgatac ctaaaacctg atacctgtga tacTCGTACA
AGAGAATAGT TAATATGTCT ATCCCGTTGT AATGGGATCC TGTTTTGTAG CAGCCCTCTT Gttagtttca tctataagct
catttaagga gcaattcgag tgataatgaa ttaagtcagt tcagcctatt cttctcatct acgtttctct gtttttctca
tcctcttctg ttcgtccccg ccggcgccac gggtcgctgg tctaccaagc ctccgaagcc ccgacctcct accacacact
catatcctat taggtcaatc cctggagctc gtgacaaAAG AGCAAAGTCC AAATTTTCAT ACACGCAGAT ACAGATAATA
TTTTAAATTC GGCCAATCCA ATTTGTCTTC CGTTGCAATG CATGAGCTCT TGGCATAGTA ACTAGCATAT GTAAGGAGTA
GTTTGTACTT TGTAAGTTTC ATGTAAATAA AAGGAAAAGC TAATTAGAAG AAGAAAACAT TTTTTATTTT TATACGAGAC
CTAAGTTATA TATACGGAAA ACCAGTTTTG CGGACGAGAC ACTTCCATTT TTCCAAACGG GTATTTCTTT TGGAACCACA
CATCCACGTG ATTTCAAAGA AAAAAAATTG TACAGATATA TAGCAAAAAT CGTCCCATTT TATAGCTAgg ataattttac
cattattgag aaggtactga gagatactat attttataat gtaaaatttg atatatctag gtaccagtac atcgagatac
taaaatttta gtgtaaaatc ttgatatctc catgtacttt cgtaaggatt ataCTTGTAG CTAACTTGGT GGACATGCAC
CGATCGAATT ACTATTTCTT TTTGTACAGA TATTATCCCA TCATGGACGC GGCAGAGATC CGCAGGTGTC CGTGGAGCGT
CAACGAGGAG CAGGAGCAGC CGGTGTTGAT CTACGACGCC AGAACCAAGA TCTCCCAGTC GTCGTCCATG CACAGCGAAT
TCTGGGCGGC CGTCCAACGG CTCACCGGCC CAGCTGCCAC GCCGGCCAAG ACCAAGAGGC ACCTCCACCT GACGACCTCG
CCTGAGCTGG AGGACGGCTT CTTGCCGGTA CGTAGTCTCG TCTTCCCGTC CGCTCCGGAT CCACGGTGCA ACATGAAGAA
GAAGAAGATG agggccggcc ctggaggggg tcgagcagtg cggtcaaact gggcccccaa atcgtagggg ccccaACCCA
GGGAGCCTGC AAAGCCTCTC TTCTGCAACA AAGCCATGCG ATGAGATGAT GCGAACAGAA ACGCCCAATT CCTACTGCAA
AGCCTCTCAG TGCCTTGCCG CCTGCCGAGT TGCCGTCGAC CGCCCCGGCG CCGCCGTTGG CTGCTGCTGC AAGCCTGAAG
ACAGCTGCAA CTGCTGATTT GCTAAACTGC GCACCTCAGC CTAACGATCA AAACTAAAAG TCTCAAGAGG TGTTGATGAT
GCGAAGTGAT CAGGTGAGCA GCAGCATGCC AGCAACACCG TCGCCATCGC CAATTGAGAT TTGTTTTAAT TCTATGATTT
TATCTGTTGG TTGTTGGTCT ATTGCCATCA TGCCATGTAC TGATGAACAG ACGTATATAT ACATGCACTA CTATGTTCCA
TGTTAGGTTA ATAGGTTTGT GACTTACTGA CTTTGTGTCT GTCTCTTATT TTTTTAGTTG TTTAAAAGAT CTGAGTTCAG
AGGGATTGAG CTTGGAGACG TGCTAGTGTG TGATGAGTCG TGCGCATCCG GACGTCTGTG AATATTTAAT TGGTAAGACT
TTAAATTTGA ATTTGTAGTT TTATGGTGTA ATTTATATGA GTATCTCCAT AAGTAATgtt tttctttcta gtacccgtca
ctgtggcata ttttgaaaga agctttttga agtcgaaatt attaaagaaa ctattgagat ctaaaatgtc gaagaaAGTG
Tttgatgcg

Locus: Os11g0684100

Loading...

Locus: Os11g0684100

Loading...