Os11t0703900-01

Locus

Os11g0703900

Description

Heat shock protein 70.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

HSP70, hsp70, OsHSP70, OsMed37_8, Med37_8

Oryzabase Gene Name Synonym(s)

heat shock protein 70, heat-shock protein 70, HEAT SHOCK PROTEIN 70KD, heat-shock protein cognate 70, Mediator 37_8

Transcript Evidence

AK065431 (DDBJ, Best hit)

AK119255 (DDBJ, Best hit)

Protein Evidence

Q40693 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Heat shock protein 70, conserved site (IPR018181)

Full-length cDNA

J013021C17 (Online Clone Ordering)

001-123-H02 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0703900-01)

Others

Oryzabase (15713)

Transcript

2379 bp

>Os11t0703900-01 Heat shock protein 70.
CTCTCCCACtcttcctcctccccaaaccctagccgccgccgccggcgtACTCGAGAGAAA
CATCAGCATCCATGGCGGGCAAGGGCGAGGGTCCGGCCATCGGCATCGACCTTGGCACGA
CCTACTCGTGCGTGGGCGTTTGGCAGCACGACCGCGTGGAGATCATCGCCAACGACCAGG
GCAACCGCACCACCCCCTCCTACGTCGGCTTCACCGACTCCGAGAGGCTCATCGGAGATG
CTGCCAAGAACCAGGTCGCCATGAACCCCATCAACACCGTCTTTGATGCCAAGCGTCTCA
TTGGCAGGAGGTTTAGCGATGCTTCTGTTCAGagtgacattaagctctggcccttcaagg
tgattgctggacctggtgacaagcctatgattgttgtccagtacaagggtgaggagaagc
agtttgctgcagaagagatctcctccatggtcctcatcaagatgcgtgagattgctgagg
cctaccttggcaccaccatcaagaatgccgttgtcactgttCCTGCCTACTTCAATGACT
CCCAGAGGCAGGCCACCAAGGATGCTGGAGTGATTGCTGGTCTCAATGTCATGCGTATCA
TCAACGAGCCGACTGCTGCAGCTATTGCCTATGGTCTTGATAAGAAGGCCACCAGCGTTG
GTGAGAAGAATGTCCTCATCTTTGACCTTGGAGGTGGTACCTTTGATGTCTCCCTCCTTA
CCATTGAGGAGGGTATCTTTGAGGTCAAGGCCACAGCTGGTGACACCCATCTTGGTGGTG
AAGATTTTGACAATCGTATGGTCAACCACTTTGTGCAAGAATTCAAGAGGAAGAACAAGA
AGGATATCACTGGCAACCCCAGGGCTCTCAGGAGGTTGAGGACAGCTTGTGAGAGGGCAA
AGAGGACCCTGTCCTCCACTGCCCAGACCACCATTGAGATCGATTCCCTGTATGAGGGCA
TCGACTTCTACTCAACCATCACCCGTGCCAGGTTTGAGGAGCTCAACATGGATCTCTTCA
GGAAGTGTATGGAGCCTGTGGAGAAGTGCCTCAGGGATGCTAAGATGGACAAGAGCTCTG
TTCATGATGTTGTCCTTGTTGGTGGCTCCACTAGGATCCCGAGGGTGCAGCAGCTCCTGC
AGGATTTCTTCAACGGCAAGGAGCTTTGCAAGAACATCAACCCAGATGAGGCTGTTGCTT
ATGGTGCTGCTGTCCAGGCTGCCATCTTGAGTGGTGAGGGCAACGAGAAGGTCCAGGACC
TCCTCCTGTTGGATGTTACCCCTCTCTCTCTCGGTTTGGAGACTGCTGGTGGTGTCATGA
CCGTTTTGATCCCAAGGAACACCACCATTCCCACCAAGAAGGAGCAGGTCTTCTCCACCT
ACTCCGACAACCAGCCTGGTGTGCTCATCCAGGTTTATGAGGGTGAGAGGACCAGGACAC
GTGACAACAACCTGCTGGGGAAGTTTGAGCTCTCTGGAATCCCTCCTGCTCCCAGGGGTG
TTCCACAGATCACTGTTTGCTTCGACATTGATGCCAATGGTATCCTGAACGTGTCTGCTG
AGGACAAGACCACCGGGCAGAAGAACAAGATCACCATTACCAACGACAAGGGCAGGCTTA
GCAAGGAGGAGATTGAGAAGATGGTCCAGGAGGCCGAGAAGTACAAGTCAGAGGATGAGG
AGCACAAGAAGAAGGTGGAGTCCAAGAACGCGCTGGAGAACTACGCCTACAACATGCGCA
ACACCATCAAGGATGAGAAGATCGCCTCGAAGCTCCCGGCAGCGGACAAGAAGAAGATCG
AGGATGCCATCGACCAGGCCATCCAGTGGCTGGACGGCAACCAGCTCGCTGAGGCTGATG
AGTTCGATGACAAGATGAAGGAGCTGGAGGGCATCTGCAACCCCATCATCGCCAAGATGT
ACCAGGGCGCTGGCGCGGACATGGCCGGCGGCATGGACGAGGACGATGCTCCCCCGGCTG
GCGGCAGCGGTGCTGGCCCCAAGATCGAGGAGGTCGACTAAGCGCGAAATTTGCTAGTGA
TCCGCGCTTCAAGTTATCTTATTGCATTATTAGTGTCTCTTTTATGTTGTGTTAAAAAAC
TTTGCTGCTATGACTTATGATGATACCCTTGGTCTGTTTGGGCAGTCCTTTTGAATTGAA
GAACTGCGTTGGGAGCTCTATGAGAACTATGAATTGCGTGAGAAATTTAATTATTGTGGT
GCTTGCAGCGCCTATTATTTGGTCTCTGTCCCACGTTTATTATTTGCATGTGCGCATTGT
TTGCTAGCAATTGCTGTTGTGCTTCTCAGCCAACATGTAAACTGTTTGGATTGTTTCTGA
TTTTTGGATGCattttttaaagcggatagtgaaggacgg

CDS

1950 bp

>Os11t0703900-01 Heat shock protein 70.
ATGGCGGGCAAGGGCGAGGGTCCGGCCATCGGCATCGACCTTGGCACGACCTACTCGTGC
GTGGGCGTTTGGCAGCACGACCGCGTGGAGATCATCGCCAACGACCAGGGCAACCGCACC
ACCCCCTCCTACGTCGGCTTCACCGACTCCGAGAGGCTCATCGGAGATGCTGCCAAGAAC
CAGGTCGCCATGAACCCCATCAACACCGTCTTTGATGCCAAGCGTCTCATTGGCAGGAGG
TTTAGCGATGCTTCTGTTCAGagtgacattaagctctggcccttcaaggtgattgctgga
cctggtgacaagcctatgattgttgtccagtacaagggtgaggagaagcagtttgctgca
gaagagatctcctccatggtcctcatcaagatgcgtgagattgctgaggcctaccttggc
accaccatcaagaatgccgttgtcactgttCCTGCCTACTTCAATGACTCCCAGAGGCAG
GCCACCAAGGATGCTGGAGTGATTGCTGGTCTCAATGTCATGCGTATCATCAACGAGCCG
ACTGCTGCAGCTATTGCCTATGGTCTTGATAAGAAGGCCACCAGCGTTGGTGAGAAGAAT
GTCCTCATCTTTGACCTTGGAGGTGGTACCTTTGATGTCTCCCTCCTTACCATTGAGGAG
GGTATCTTTGAGGTCAAGGCCACAGCTGGTGACACCCATCTTGGTGGTGAAGATTTTGAC
AATCGTATGGTCAACCACTTTGTGCAAGAATTCAAGAGGAAGAACAAGAAGGATATCACT
GGCAACCCCAGGGCTCTCAGGAGGTTGAGGACAGCTTGTGAGAGGGCAAAGAGGACCCTG
TCCTCCACTGCCCAGACCACCATTGAGATCGATTCCCTGTATGAGGGCATCGACTTCTAC
TCAACCATCACCCGTGCCAGGTTTGAGGAGCTCAACATGGATCTCTTCAGGAAGTGTATG
GAGCCTGTGGAGAAGTGCCTCAGGGATGCTAAGATGGACAAGAGCTCTGTTCATGATGTT
GTCCTTGTTGGTGGCTCCACTAGGATCCCGAGGGTGCAGCAGCTCCTGCAGGATTTCTTC
AACGGCAAGGAGCTTTGCAAGAACATCAACCCAGATGAGGCTGTTGCTTATGGTGCTGCT
GTCCAGGCTGCCATCTTGAGTGGTGAGGGCAACGAGAAGGTCCAGGACCTCCTCCTGTTG
GATGTTACCCCTCTCTCTCTCGGTTTGGAGACTGCTGGTGGTGTCATGACCGTTTTGATC
CCAAGGAACACCACCATTCCCACCAAGAAGGAGCAGGTCTTCTCCACCTACTCCGACAAC
CAGCCTGGTGTGCTCATCCAGGTTTATGAGGGTGAGAGGACCAGGACACGTGACAACAAC
CTGCTGGGGAAGTTTGAGCTCTCTGGAATCCCTCCTGCTCCCAGGGGTGTTCCACAGATC
ACTGTTTGCTTCGACATTGATGCCAATGGTATCCTGAACGTGTCTGCTGAGGACAAGACC
ACCGGGCAGAAGAACAAGATCACCATTACCAACGACAAGGGCAGGCTTAGCAAGGAGGAG
ATTGAGAAGATGGTCCAGGAGGCCGAGAAGTACAAGTCAGAGGATGAGGAGCACAAGAAG
AAGGTGGAGTCCAAGAACGCGCTGGAGAACTACGCCTACAACATGCGCAACACCATCAAG
GATGAGAAGATCGCCTCGAAGCTCCCGGCAGCGGACAAGAAGAAGATCGAGGATGCCATC
GACCAGGCCATCCAGTGGCTGGACGGCAACCAGCTCGCTGAGGCTGATGAGTTCGATGAC
AAGATGAAGGAGCTGGAGGGCATCTGCAACCCCATCATCGCCAAGATGTACCAGGGCGCT
GGCGCGGACATGGCCGGCGGCATGGACGAGGACGATGCTCCCCCGGCTGGCGGCAGCGGT
GCTGGCCCCAAGATCGAGGAGGTCGACTAA

Protein

650 aa

>Os11t0703900-01 Heat shock protein 70.
MAGKGEGPAIGIDLGTTYSCVGVWQHDRVEIIANDQGNRTTPSYVGFTDSERLIGDAAKN
QVAMNPINTVFDAKRLIGRRFSDASVQSDIKLWPFKVIAGPGDKPMIVVQYKGEEKQFAA
EEISSMVLIKMREIAEAYLGTTIKNAVVTVPAYFNDSQRQATKDAGVIAGLNVMRIINEP
TAAAIAYGLDKKATSVGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFD
NRMVNHFVQEFKRKNKKDITGNPRALRRLRTACERAKRTLSSTAQTTIEIDSLYEGIDFY
STITRARFEELNMDLFRKCMEPVEKCLRDAKMDKSSVHDVVLVGGSTRIPRVQQLLQDFF
NGKELCKNINPDEAVAYGAAVQAAILSGEGNEKVQDLLLLDVTPLSLGLETAGGVMTVLI
PRNTTIPTKKEQVFSTYSDNQPGVLIQVYEGERTRTRDNNLLGKFELSGIPPAPRGVPQI
TVCFDIDANGILNVSAEDKTTGQKNKITITNDKGRLSKEEIEKMVQEAEKYKSEDEEHKK
KVESKNALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDD
KMKELEGICNPIIAKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD*

5'UTR

chr11:28804256..28804326 (+ strand) : 71 bp

CDS

chr11:28804327..28804540 (+ strand) : 214 bp

chr11:28806455..28808190 (+ strand) : 1736 bp

3'UTR

chr11:28808191..28808548 (+ strand) : 358 bp

FASTA

>Os11t0703900-01 class=Sequence position=chr11:28804256..28808548 (+ strand)
CTCTCCCACt cttcctcctc cccaaaccct agccgccgcc gccggcgtAC TCGAGAGAAA CATCAGCATC CATGGCGGGC
AAGGGCGAGG GTCCGGCCAT CGGCATCGAC CTTGGCACGA CCTACTCGTG CGTGGGCGTT TGGCAGCACG ACCGCGTGGA
GATCATCGCC AACGACCAGG GCAACCGCAC CACCCCCTCC TACGTCGGCT TCACCGACTC CGAGAGGCTC ATCGGAGATG
CTGCCAAGAA CCAGGTCGCC ATGAACCCCA TCAACACCGT CTTTGGTAAC TACTTATTCC CTGCTCCTCA GTCCTCTCTC
TTTCTCTCTC TCCCCCCTTA GATCTCATCT CTAAGGTCTT CGTCGTCGTC GTATGCTAGA TCTACTCTTG CCCAGCTCGT
TCAGATCTGT TAGATTTGTG TGGGATGCTC TAATTAATTA CTACCAACTT AGTAGATCTG GAACTCTTTT GACTTGCAGA
TCTTGCTCCA CTCCTGTTGC ATTTTGAATC TGTGTTGATG TGATTTAAGT TGTTGGCAGT GCTTTTTGCA TACTATTTGA
ATTTGTGGAT GGTTAGCAGT CAGTACACTA GGATTTATTA CTGGATCTGG ACAGATATGC TCGTTTCAAT CGGCTCGATT
TGCTATGTTG ATAGCTAACA TGTTGTGCTT GTCCTACTGC CCTGGCGCAA ATTTGATCCA TGCATTCTTT TCGTTAAATG
ATTTGTCAAG TAGTAATGCT TGTTTGAAAA TGATATTATT ATTATTATTA TTATTTTAAA TAAATATAGC CTGAAACATT
CTTAGTTTCG AGGAGAAGTG ATGATGTCTT ATCCATACCA CATGTCTGCA TCTCATATGA TGATTAATCT ACATCATGCA
CTACCATCTG ATCTCCTCTA GCTCATACAG CTTTTAACAA GTTAGGCGAT AGATGTTTGC TACAAACAGT CAACTGGATT
TGCTTTCTTG AAAGAAAAAA AATGAACCGT GTAGTTTGCA ACCTGTGATG TAAATTAACC CATTTACTGA ACTACATTGA
TTATTTCAGT AAAATCACCA TCTTTCGGCT GAGGTTGCAT GCTTAGTTAT TATATTTTTA CCAATGATGA TTTTGTTATG
TAGCCAGATA CTGTACTTTC TTATGCCATT TGGTATCTGA CTCATTGTCT ACTTTTGTGA CTATGTGTCT CGAAATATGG
CATATAATAA GGGGGAACGG ATCTTGCGAC ATTGATGGCT CCTGTATGAG CCTCCAATTA CTATATAGCC GTTTACATGT
TCTTATCATG TTACTTTTCC AAATTAGTGC TGCACATCTT GTCTGTTTGC AAGTTTGGGT TCATTCATAT TGCTGTGGGC
ATTTTAATAC ATCTTAACTA TAATGTAAAT TTCTTGTACA TCGCTAAAAT TTTCTGCCTT GATTGAGTAG ACTCTTAGAT
GACATCTATC TTACCTTATG CACTTGATTC GTATTTCTGT TACAACATTT TGATTACTTG ATGTAGTTCA CACAAGCATG
ACACATCTCT TTGAAAAAAA GATTTCATTT TTTAAAGCAA GCCTAATGCT TTAGGGTGGG AGAAGTGATG ATACTTAATC
CATACAACAT TTCTGCATCT CAGATGATGA TCAATCTACA TCATGCACTA CCATCTGATC TCCCCATCAT ACAATTTTTT
ATTTTGTTTT GTTGGATTAT ATAACTTTAA CATTTGATAA AGTGCCAACA GATTTTTATA CACAATTTCT TATAGATATT
ACCATGACAG CTTGCAGCCT GTGATGCAAA AGTACCCATT AAACTGAATT ACACTGATTA TTCCAAACAA ATCACCATCT
TTCGGCTGAG GTTGCTTGCT TGTTTAAAAT TATGAATGCT TCTTGCACAA CCATTTAGGA CTTTCGGTAG TTTGTAATGC
CATTTGGTAT CTGACACATG GTCTGCGCTT GTGACTATTT GTCTTGAAAT ATGGCATAAA ACAAGGGGGA ACGGATCTTG
CGACATTGGT GGTTCCTCTA TGATCCTCCA ATTACTATAT AGCTGTTTAC AATTTGTTAA GTTAGGAGCA TACCTTTTGC
TTTGTCATCA AAGTCTTGGT TCCTTTGTAT TTCTAGTTCA GATTCATTTT TCTTCAGCTT TTGAAACATA AACTCAGTAT
ATTTTTACTG TAATTGCTGA CATTGAGTCT TCTCTGCAGA TGCCAAGCGT CTCATTGGCA GGAGGTTTAG CGATGCTTCT
GTTCAGagtg acattaagct ctggcccttc aaggtgattg ctggacctgg tgacaagcct atgattgttg tccagtacaa
gggtgaggag aagcagtttg ctgcagaaga gatctcctcc atggtcctca tcaagatgcg tgagattgct gaggcctacc
ttggcaccac catcaagaat gccgttgtca ctgttCCTGC CTACTTCAAT GACTCCCAGA GGCAGGCCAC CAAGGATGCT
GGAGTGATTG CTGGTCTCAA TGTCATGCGT ATCATCAACG AGCCGACTGC TGCAGCTATT GCCTATGGTC TTGATAAGAA
GGCCACCAGC GTTGGTGAGA AGAATGTCCT CATCTTTGAC CTTGGAGGTG GTACCTTTGA TGTCTCCCTC CTTACCATTG
AGGAGGGTAT CTTTGAGGTC AAGGCCACAG CTGGTGACAC CCATCTTGGT GGTGAAGATT TTGACAATCG TATGGTCAAC
CACTTTGTGC AAGAATTCAA GAGGAAGAAC AAGAAGGATA TCACTGGCAA CCCCAGGGCT CTCAGGAGGT TGAGGACAGC
TTGTGAGAGG GCAAAGAGGA CCCTGTCCTC CACTGCCCAG ACCACCATTG AGATCGATTC CCTGTATGAG GGCATCGACT
TCTACTCAAC CATCACCCGT GCCAGGTTTG AGGAGCTCAA CATGGATCTC TTCAGGAAGT GTATGGAGCC TGTGGAGAAG
TGCCTCAGGG ATGCTAAGAT GGACAAGAGC TCTGTTCATG ATGTTGTCCT TGTTGGTGGC TCCACTAGGA TCCCGAGGGT
GCAGCAGCTC CTGCAGGATT TCTTCAACGG CAAGGAGCTT TGCAAGAACA TCAACCCAGA TGAGGCTGTT GCTTATGGTG
CTGCTGTCCA GGCTGCCATC TTGAGTGGTG AGGGCAACGA GAAGGTCCAG GACCTCCTCC TGTTGGATGT TACCCCTCTC
TCTCTCGGTT TGGAGACTGC TGGTGGTGTC ATGACCGTTT TGATCCCAAG GAACACCACC ATTCCCACCA AGAAGGAGCA
GGTCTTCTCC ACCTACTCCG ACAACCAGCC TGGTGTGCTC ATCCAGGTTT ATGAGGGTGA GAGGACCAGG ACACGTGACA
ACAACCTGCT GGGGAAGTTT GAGCTCTCTG GAATCCCTCC TGCTCCCAGG GGTGTTCCAC AGATCACTGT TTGCTTCGAC
ATTGATGCCA ATGGTATCCT GAACGTGTCT GCTGAGGACA AGACCACCGG GCAGAAGAAC AAGATCACCA TTACCAACGA
CAAGGGCAGG CTTAGCAAGG AGGAGATTGA GAAGATGGTC CAGGAGGCCG AGAAGTACAA GTCAGAGGAT GAGGAGCACA
AGAAGAAGGT GGAGTCCAAG AACGCGCTGG AGAACTACGC CTACAACATG CGCAACACCA TCAAGGATGA GAAGATCGCC
TCGAAGCTCC CGGCAGCGGA CAAGAAGAAG ATCGAGGATG CCATCGACCA GGCCATCCAG TGGCTGGACG GCAACCAGCT
CGCTGAGGCT GATGAGTTCG ATGACAAGAT GAAGGAGCTG GAGGGCATCT GCAACCCCAT CATCGCCAAG ATGTACCAGG
GCGCTGGCGC GGACATGGCC GGCGGCATGG ACGAGGACGA TGCTCCCCCG GCTGGCGGCA GCGGTGCTGG CCCCAAGATC
GAGGAGGTCG ACTAAGCGCG AAATTTGCTA GTGATCCGCG CTTCAAGTTA TCTTATTGCA TTATTAGTGT CTCTTTTATG
TTGTGTTAAA AAACTTTGCT GCTATGACTT ATGATGATAC CCTTGGTCTG TTTGGGCAGT CCTTTTGAAT TGAAGAACTG
CGTTGGGAGC TCTATGAGAA CTATGAATTG CGTGAGAAAT TTAATTATTG TGGTGCTTGC AGCGCCTATT ATTTGGTCTC
TGTCCCACGT TTATTATTTG CATGTGCGCA TTGTTTGCTA GCAATTGCTG TTGTGCTTCT CAGCCAACAT GTAAACTGTT
TGGATTGTTT CTGATTTTTG GATGCatttt ttaaagcgga tagtgaagga cgg

Locus: Os11g0703900

Loading...

Locus: Os11g0703900

Loading...