Os11t0703900-02

Locus

Os11g0703900

Description

Similar to Heat shock protein 70.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

HSP70, hsp70, OsHSP70, OsMed37_8, Med37_8

Oryzabase Gene Name Synonym(s)

heat shock protein 70, heat-shock protein 70, HEAT SHOCK PROTEIN 70KD, heat-shock protein cognate 70, Mediator 37_8

Transcript Evidence

AK119710 (DDBJ, Best hit)

Protein Evidence

Q40693 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Full-length cDNA

002-157-E11 (Online Clone Ordering)

Expression Databases

TENOR (Os11t0703900-02)

RiceXPro (AK119710)

Others

Oryzabase (15713)

KEGG (Os11t0703900-02)

Transcript

529 bp

>Os11t0703900-02 Similar to Heat shock protein 70.
ACGCGCTGGAGAACTACGCCTACAACATGCGCAACACCATCAAGGATGAGAAGATCGCCT
CGAAGCTCCCGGCAGCGGACAAGAAGAAGATCGAGGATGCCATCGACCAGGCCATCCAGT
GGCTGGACGGCAACCAGCTCGCTGAGGCTGATGAGTTCGATGACAAGATGAAGGAGCTGG
AGGGCATCTGCAACCCCATCATCGCCAAGATGTACCAGGGCGCTGGCGCGGACATGGCCG
GCGGCATGGACGAGGACGATGCTCCCCCGGCTGGCGGCAGCGGTGCTGGCCCCAAGATCG
AGGAGGTCGACTAAGCGCGAAATTTGCTAGTGATCCGCGCTTCAAGTTATCTTATTGCAT
TATTAGTGTCTCTTTTATGTTGTGTTAAAAAACTTTGCTGCTATGACTTATGATGATACC
CTTGGTCTGTTTGGGCAGTCCTTTTGAATTGAAGAACTGCGTTGGGAGCTCTATGAGAAC
TATGAATTGCGTGAGAAATTTAATTATTGTGGTGCTTGCAGCGCCTATT

CDS

312 bp

>Os11t0703900-02 Similar to Heat shock protein 70.
GCGCTGGAGAACTACGCCTACAACATGCGCAACACCATCAAGGATGAGAAGATCGCCTCG
AAGCTCCCGGCAGCGGACAAGAAGAAGATCGAGGATGCCATCGACCAGGCCATCCAGTGG
CTGGACGGCAACCAGCTCGCTGAGGCTGATGAGTTCGATGACAAGATGAAGGAGCTGGAG
GGCATCTGCAACCCCATCATCGCCAAGATGTACCAGGGCGCTGGCGCGGACATGGCCGGC
GGCATGGACGAGGACGATGCTCCCCCGGCTGGCGGCAGCGGTGCTGGCCCCAAGATCGAG
GAGGTCGACTAA

Protein

104 aa

>Os11t0703900-02 Similar to Heat shock protein 70.
ALENYAYNMRNTIKDEKIASKLPAADKKKIEDAIDQAIQWLDGNQLAEADEFDDKMKELE
GICNPIIAKMYQGAGADMAGGMDEDDAPPAGGSGAGPKIEEVD*

5'UTR

chr11:28807877..28807878 (+ strand) : 2 bp

CDS

chr11:28807879..28808190 (+ strand) : 312 bp

3'UTR

chr11:28808191..28808405 (+ strand) : 215 bp

FASTA

>Os11t0703900-02 class=Sequence position=chr11:28807877..28808405 (+ strand)
ACGCGCTGGA GAACTACGCC TACAACATGC GCAACACCAT CAAGGATGAG AAGATCGCCT CGAAGCTCCC GGCAGCGGAC
AAGAAGAAGA TCGAGGATGC CATCGACCAG GCCATCCAGT GGCTGGACGG CAACCAGCTC GCTGAGGCTG ATGAGTTCGA
TGACAAGATG AAGGAGCTGG AGGGCATCTG CAACCCCATC ATCGCCAAGA TGTACCAGGG CGCTGGCGCG GACATGGCCG
GCGGCATGGA CGAGGACGAT GCTCCCCCGG CTGGCGGCAG CGGTGCTGGC CCCAAGATCG AGGAGGTCGA CTAAGCGCGA
AATTTGCTAG TGATCCGCGC TTCAAGTTAT CTTATTGCAT TATTAGTGTC TCTTTTATGT TGTGTTAAAA AACTTTGCTG
CTATGACTTA TGATGATACC CTTGGTCTGT TTGGGCAGTC CTTTTGAATT GAAGAACTGC GTTGGGAGCT CTATGAGAAC
TATGAATTGC GTGAGAAATT TAATTATTGT GGTGCTTGCA GCGCCTATT

Locus: Os11g0703900

Loading...

Locus: Os11g0703900

Loading...