Os12t0106300-01

Locus

Os12g0106300

Description

Xylan acetyltransferase, Resistance to bacterial leaf blight disease

RAP-DB Gene Symbol Synonym(s)

OsTBL1, TBL1

RAP-DB Gene Name Synonym(s)

trichome birefringence-like 1

CGSNL Gene Symbol

XOAT13

CGSNL Gene Name

XYLAN O-ACETYLTRANSFERASE 13

Oryzabase Gene Symbol Synonym(s)

OsTBL1, TBL1, OsXOAT13

Oryzabase Gene Name Synonym(s)

trichome birefringence-like 1, xylan O-acetyltransferase 13

Transcript Evidence

AK060755

Protein Evidence

Q2QYU2

Literature

PMID: 27864442

Note

Manual Curation

January 4, 2017

Functional domain (InterPro)

PC-Esterase (IPR026057)

Trichome birefringence-like family (IPR029962)

PMR5 N-terminal domain (IPR025846)

Full-length cDNA

001-032-H01 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0106300-01)

RiceXPro (AK060755)

Others

Oryzabase (21456)

KEGG (Os12t0106300-01)

Transcript

1858 bp

>Os12t0106300-01 Xylan acetyltransferase, Resistance to bacterial leaf blight disease
ACACAACCATTCCAATTCTATTCTAACCCATTTATAAGCTCCTTCATTGGAGGTTAGCCC
AAGGGTCAGTGTTGCTTGAGAGGTACTCACCCTGTGCAGGTGCCAGTGGACTCAGGCCAT
TTAGCTAGCTAGCCAAAGCCAATTGCCATGTGGAGTGCTCTCTTCTCCCATCTGAGAGAG
GTTCACAAGAGAAGCGGAGTTAAGGAGGAGAAGTTGATAATGAAGTCGCCACCAGCAGCA
GGTGAGGCCGGCTGCCACAAGCCACAGGCGACTGCCACCAACAAGATGACGGTGCTGCAG
TCCCCGCTGGGGCTCAGGACCATCCTCACCTCCCTCGTCGCCTTCTTCATCGTCGTCAGC
TCCGTCTCCCTCCTCTTCGACCGCGGCCAGGATGCTCAGGCGCAACTCGCCGTCGAGCAG
CATCAGCACCAAGAAGTTCTGCTCAAGCAGAAGCCGGCATCAGCAGCAGTGGGCGAGCAG
AAATCAGTGGTAGTAGATCAGTCGTCGTTGAGGAGCCAGGAGGCGCAGGTGCAGTGGACA
TCTGAGCTGCAGGACGTGGCCACGGACAGCGGCGACGGCGGCTTCGACGGCGAGGAGGAC
TGCAACTGGTCGTTGGGACGGTGGGTGTACGACAACGCGTCGCGGCCACTCTACTCCGGC
TTGAAGTGCTCCTTCATCTTCGACGAGGTGGCCTGCGACAAGTATGGAAGGAATGACACC
AAGTACCAGCACTGGAGATGGCAGCCTCACGGTTGCAACCTTCCAAGATTCAATGCCACA
AAGTTTCTTGAAAAGCTTAGGAACAAGAGACTGGTTTTTGTGGGCGATTCAGTAAACAGA
AATCAATGGGTGTCGATGGTGTGCATGGTGGAGCACTTCATCCCTGATGGCCGCAAGATG
CGCGTTTACAACGGCTCCCTTATCTCCTTCAAAGCATTTgagtacaatgcgacgatagat
ttctactggtcaccactgctattggaatcaaacagcgacaaccccataattcacagagtg
gagtaccggatcataagggcagacaggattgagaaacacgccaatgtctggaaggacgct
gatttcatcgtcttcaactcctacctttggtggaggaagcagagggatggtatgatgatg
aaagtcatGTATGGTTCATTTGAGGACGGGGATGCAAAGTTAGATGAGGTGCAAATGGTT
GATGGTTATGAGATAGCTCTCAAGAAACTAACTGAATATCTTGGAGCCAATATCAACAAG
AACAAGACTAGAATCTTCTTTGCAGGCTCATCACCTGCCCATTCCTGGGCTAGCAACTGG
GGAGGAGATGACAACAACAAGTGTCTAAACGAAACAGAACCAATTCAGATAGAAGATTAT
AGGAGTGCAACCACAGACTACGGCATGATGGACAAGGCGAAGGAGATATTTGGAACACTG
GAACCAAAGGGCATACATGTTCAGATACTGAACATCACCCAGCTTTCTGAGTACCGCAAG
GACGCCCATCCAACGATATTCAGGAGACAGTACGTTCCTCTGACGAAAGAGCAGATTGCA
AACCCGAGCATCTACGCAGACTGCACGCATTGGTGCCTCCCTGGAGTTCCTGATGTTTGG
AACGAGTTCTTGTATGCATACATTATGCACAAATGATATATGTATAATAATGTAATCTTA
ATTTGGCCAAATTTCTTCTTTGTTAACTTGTGGGTGTCTAAGTAGGTATAAGTGCACAGT
ACTTGGCCCCCATCAATTTTTTTTTCTTTTTTGACATTTACATCATTACATTACATGTAA
AGAGAAAGGGAAGAACATAAGCGCAGAAATGAAAAGGAAGAAGATAAGTTAATTTGCC

CDS

1509 bp

>Os12t0106300-01 Xylan acetyltransferase, Resistance to bacterial leaf blight disease
ATGTGGAGTGCTCTCTTCTCCCATCTGAGAGAGGTTCACAAGAGAAGCGGAGTTAAGGAG
GAGAAGTTGATAATGAAGTCGCCACCAGCAGCAGGTGAGGCCGGCTGCCACAAGCCACAG
GCGACTGCCACCAACAAGATGACGGTGCTGCAGTCCCCGCTGGGGCTCAGGACCATCCTC
ACCTCCCTCGTCGCCTTCTTCATCGTCGTCAGCTCCGTCTCCCTCCTCTTCGACCGCGGC
CAGGATGCTCAGGCGCAACTCGCCGTCGAGCAGCATCAGCACCAAGAAGTTCTGCTCAAG
CAGAAGCCGGCATCAGCAGCAGTGGGCGAGCAGAAATCAGTGGTAGTAGATCAGTCGTCG
TTGAGGAGCCAGGAGGCGCAGGTGCAGTGGACATCTGAGCTGCAGGACGTGGCCACGGAC
AGCGGCGACGGCGGCTTCGACGGCGAGGAGGACTGCAACTGGTCGTTGGGACGGTGGGTG
TACGACAACGCGTCGCGGCCACTCTACTCCGGCTTGAAGTGCTCCTTCATCTTCGACGAG
GTGGCCTGCGACAAGTATGGAAGGAATGACACCAAGTACCAGCACTGGAGATGGCAGCCT
CACGGTTGCAACCTTCCAAGATTCAATGCCACAAAGTTTCTTGAAAAGCTTAGGAACAAG
AGACTGGTTTTTGTGGGCGATTCAGTAAACAGAAATCAATGGGTGTCGATGGTGTGCATG
GTGGAGCACTTCATCCCTGATGGCCGCAAGATGCGCGTTTACAACGGCTCCCTTATCTCC
TTCAAAGCATTTgagtacaatgcgacgatagatttctactggtcaccactgctattggaa
tcaaacagcgacaaccccataattcacagagtggagtaccggatcataagggcagacagg
attgagaaacacgccaatgtctggaaggacgctgatttcatcgtcttcaactcctacctt
tggtggaggaagcagagggatggtatgatgatgaaagtcatGTATGGTTCATTTGAGGAC
GGGGATGCAAAGTTAGATGAGGTGCAAATGGTTGATGGTTATGAGATAGCTCTCAAGAAA
CTAACTGAATATCTTGGAGCCAATATCAACAAGAACAAGACTAGAATCTTCTTTGCAGGC
TCATCACCTGCCCATTCCTGGGCTAGCAACTGGGGAGGAGATGACAACAACAAGTGTCTA
AACGAAACAGAACCAATTCAGATAGAAGATTATAGGAGTGCAACCACAGACTACGGCATG
ATGGACAAGGCGAAGGAGATATTTGGAACACTGGAACCAAAGGGCATACATGTTCAGATA
CTGAACATCACCCAGCTTTCTGAGTACCGCAAGGACGCCCATCCAACGATATTCAGGAGA
CAGTACGTTCCTCTGACGAAAGAGCAGATTGCAAACCCGAGCATCTACGCAGACTGCACG
CATTGGTGCCTCCCTGGAGTTCCTGATGTTTGGAACGAGTTCTTGTATGCATACATTATG
CACAAATGA

Protein

503 aa

>Os12t0106300-01 Xylan acetyltransferase, Resistance to bacterial leaf blight disease
MWSALFSHLREVHKRSGVKEEKLIMKSPPAAGEAGCHKPQATATNKMTVLQSPLGLRTIL
TSLVAFFIVVSSVSLLFDRGQDAQAQLAVEQHQHQEVLLKQKPASAAVGEQKSVVVDQSS
LRSQEAQVQWTSELQDVATDSGDGGFDGEEDCNWSLGRWVYDNASRPLYSGLKCSFIFDE
VACDKYGRNDTKYQHWRWQPHGCNLPRFNATKFLEKLRNKRLVFVGDSVNRNQWVSMVCM
VEHFIPDGRKMRVYNGSLISFKAFEYNATIDFYWSPLLLESNSDNPIIHRVEYRIIRADR
IEKHANVWKDADFIVFNSYLWWRKQRDGMMMKVMYGSFEDGDAKLDEVQMVDGYEIALKK
LTEYLGANINKNKTRIFFAGSSPAHSWASNWGGDDNNKCLNETEPIQIEDYRSATTDYGM
MDKAKEIFGTLEPKGIHVQILNITQLSEYRKDAHPTIFRRQYVPLTKEQIANPSIYADCT
HWCLPGVPDVWNEFLYAYIMHK*

5'UTR

chr12:337846..337992 (+ strand) : 147 bp

CDS

chr12:337993..338612 (+ strand) : 620 bp

chr12:339727..339898 (+ strand) : 172 bp

chr12:339996..340204 (+ strand) : 209 bp

chr12:340414..340572 (+ strand) : 159 bp

chr12:340914..341262 (+ strand) : 349 bp

3'UTR

chr12:341263..341464 (+ strand) : 202 bp

FASTA

>Os12t0106300-01 class=Sequence position=chr12:337846..341464 (+ strand)
ACACAACCAT TCCAATTCTA TTCTAACCCA TTTATAAGCT CCTTCATTGG AGGTTAGCCC AAGGGTCAGT GTTGCTTGAG
AGGTACTCAC CCTGTGCAGG TGCCAGTGGA CTCAGGCCAT TTAGCTAGCT AGCCAAAGCC AATTGCCATG TGGAGTGCTC
TCTTCTCCCA TCTGAGAGAG GTTCACAAGA GAAGCGGAGT TAAGGAGGAG AAGTTGATAA TGAAGTCGCC ACCAGCAGCA
GGTGAGGCCG GCTGCCACAA GCCACAGGCG ACTGCCACCA ACAAGATGAC GGTGCTGCAG TCCCCGCTGG GGCTCAGGAC
CATCCTCACC TCCCTCGTCG CCTTCTTCAT CGTCGTCAGC TCCGTCTCCC TCCTCTTCGA CCGCGGCCAG GATGCTCAGG
CGCAACTCGC CGTCGAGCAG CATCAGCACC AAGAAGTTCT GCTCAAGCAG AAGCCGGCAT CAGCAGCAGT GGGCGAGCAG
AAATCAGTGG TAGTAGATCA GTCGTCGTTG AGGAGCCAGG AGGCGCAGGT GCAGTGGACA TCTGAGCTGC AGGACGTGGC
CACGGACAGC GGCGACGGCG GCTTCGACGG CGAGGAGGAC TGCAACTGGT CGTTGGGACG GTGGGTGTAC GACAACGCGT
CGCGGCCACT CTACTCCGGC TTGAAGTGCT CCTTCATCTT CGACGAGGTG GCCTGCGACA AGTATGGAAG GAATGACACC
AAGTACCAGC ACTGGAGATG GCAGCCTCAC GGTTGCAACC TTCCAAGGTA TCAACACAAC TCATCTCCAT TCTAATCCAC
ATCAATTTTG ACACTACGTA CACTCACTAC TGCTGCAAGG ATCTGAAACT GCACTACTAC TTAGTACTAC ACTCCGTTCG
TACTAGCTGT CTCAGTGTTT CTTACCAAAC TTCCAACTTG ACCTACTCAT GGTAACAAAA ACGTTTTTAG TTTTGTGAAA
GCAGGGGAAA ATGTTCTCTC CTAGTCCTGC AGGAAAAAAA AATCAACTTT ATTTTTTTTT TCAGATTGCT CTTGTAACCC
AGAGTCCTAG GTGCCAACTG GAAAACATAC AGAGAAAAAT TGGTTGGTTT TGAGTTCTTT AAACAACGGT TAGTTTTGGG
GAATAAATTA TTGGACAGCA AAAGATCGGT TGTTTTTTTA GATAACCAAA GATACAGTTT GTGAAAGATC AGTTATGAGA
GAACCAATCG CCAATGCTTA CTTGATAAAG AACTTCAGAA GTTCTTTTTT TTTTCTTCTG ATATGGTGTC GCACTCATAA
GAATGGAcct tttaaattcc tatataatgg tcaaatccat tggaagtttt gaggaaatat aacatgaagt ccaagctctt
gataatttcc tttgtgtcat cctctcttca aattcctgta ctgttatgaa gcatccaaaa aacacaattg agtaattcct
atatttttca tattccttat gattacattg acacgtcact tcaatttctg tgcttttctt attcttgtgt tttcctgtgt
ttctcaattc ctttgatcca aagAGTCAGT TAATATGTTC CTCCCATAAT TAATACCCAA TTAAAATAGT ACAAGGTACC
TAGTGGAAAG AAAAAAAAAA CGTCATTTAT AATGTGTCCA GATTGCTAAA TTTATAATAT GGTTGCTTCT GTAATCCAAT
GGCCAACTAG AAAACGTACA GACAAACTAT TGATTACTTT TGAGTTATTC TTAAAAAAAT TGTTAGTTCT CAGGACTAAA
CTATTAACAG TGAAAGATCC GTTATGAAAC ACAAACCAAT CACTATTCAC TAATGCTTAC TATGGATTAA TTGTTTTTTT
TTCTGATATA TGGTGTCGCA ATCTTTACCC TGTCAAAACA GATTCAATGC CACAAAGTTT CTTGAAAAGC TTAGGAACAA
GAGACTGGTT TTTGTGGGCG ATTCAGTAAA CAGAAATCAA TGGGTGTCGA TGGTGTGCAT GGTGGAGCAC TTCATCCCTG
ATGGCCGCAA GATGCGCGTT TACAACGGCT CCCTTATCTC CTTCAAAGCA TTTGTATGTC TCACTAATCT CTTCATCCCA
ACATGCTTCT GAATTCAGAA ATCAGAAACA GTACATTCTC TGATCTGAAC ATTTCTTCTG TTtgctccag gagtacaatg
cgacgataga tttctactgg tcaccactgc tattggaatc aaacagcgac aaccccataa ttcacagagt ggagtaccgg
atcataaggg cagacaggat tgagaaacac gccaatgtct ggaaggacgc tgatttcatc gtcttcaact cctacctttg
gtggaggaag cagagggatg gtatgatgat gaaagtcatg taagtactta atttttactc cTCTTTCTTT CCTGGTCAGA
AAAAAAATGT TGCTCTTTTT TCTTATTCCA ATGCAACAAA GTGGGGTTTG GAGGCATCAG AAAGTTTTAC TACTTTTTCA
GTCAAAAAAA GTTTCCTTTT TTTCTCTTTC CAATGCAACA AACTCTGATT TGGAGGTATG ATCAGTAAGT CATTATGCAA
AAATGTAGGT ATGGTTCATT TGAGGACGGG GATGCAAAGT TAGATGAGGT GCAAATGGTT GATGGTTATG AGATAGCTCT
CAAGAAACTA ACTGAATATC TTGGAGCCAA TATCAACAAG AACAAGACTA GAATCTTCTT TGCAGGCTCA TCACCTGCCC
ATTCCTGGTG AGAGAACGTA CAACTCTTGC ATCATTTCTC AACTGCGAAA CATTCTGAAA ACCAATAAAA TTCATCAGCT
CTACTCAAGT TCAAAGCTTG CTTATATTTT TGACACTGAA Aatgaaaaaa aaacacaaat attagggaaa gacctaatat
caaataatta gaagggatga gactttgaac ccatgccggc tagctccagg cccaccacct tgtggagcta gccggaagat
ccctgggtgt ttctcatgac aCTGAAAATG GCAATTAATC TACACTGAAA ATGACAATCA TGTGCATTCT GACAAGAAAA
TTCTGGAACA AAAATGGATG TTTTCCAGGG CTAGCAACTG GGGAGGAGAT GACAACAACA AGTGTCTAAA CGAAACAGAA
CCAATTCAGA TAGAAGATTA TAGGAGTGCA ACCACAGACT ACGGCATGAT GGACAAGGCG AAGGAGATAT TTGGAACACT
GGAACCAAAG GGCATACATG TTCAGATACT GAACATCACC CAGCTTTCTG AGTACCGCAA GGACGCCCAT CCAACGATAT
TCAGGAGACA GTACGTTCCT CTGACGAAAG AGCAGATTGC AAACCCGAGC ATCTACGCAG ACTGCACGCA TTGGTGCCTC
CCTGGAGTTC CTGATGTTTG GAACGAGTTC TTGTATGCAT ACATTATGCA CAAATGATAT ATGTATAATA ATGTAATCTT
AATTTGGCCA AATTTCTTCT TTGTTAACTT GTGGGTGTCT AAGTAGGTAT AAGTGCACAG TACTTGGCCC CCATCAATTT
TTTTTTCTTT TTTGACATTT ACATCATTAC ATTACATGTA AAGAGAAAGG GAAGAACATA AGCGCAGAAA TGAAAAGGAA
GAAGATAAGT TAATTTGCC

Locus: Os12g0106300

Loading...

Locus: Os12g0106300

Loading...