Os12t0108900-00

Locus

Os12g0108900

Description

Similar to DRM-type DNA-methyltransferase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

DRM1B

CGSNL Gene Name

DOMAINS REARRANGED METHYLTRANSFERASE 1B

Oryzabase Gene Symbol Synonym(s)

OsDRM1b

Oryzabase Gene Name Synonym(s)

domains rearranged methyltransferase 1b, domains rearranged methylase 1b

Transcript Evidence

AK365109 (DDBJ)

Protein Evidence

B4XTT0 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

UBA-like (IPR009060)

Ubiquitin-associated/translation elongation factor EF1B, N-terminal, eukaryote (IPR015940)

Expression Databases

TENOR (Os12t0108900-00)

Others

Oryzabase (10398)

Transcript

1799 bp

>Os12t0108900-00 Similar to DRM-type DNA-methyltransferase.
GGACTGGGCTAGCGACAACGATGAGgatagcgagttcgagtgggatactgatggtgagtt
tgaggcctcgtctgctccagccttttcgaacacggatgcacctggtctgtccacgagCTG
GATGCTAATGGGAAGGCCAATGGATCAGCACCATCAGCTTTGGTGGCTTACTTTTTGGGA
ATGGGTTTCTCGAGAGAGATGGTCTTCAGAGCTATCAAGGAGATTGGTAATGATAACAAT
AATACATTTCCTCATTTGCTTCAACTGTTGCCGCGATAGGCAGTGACCCTTCAGTGGGTA
ACAGCTCTCATTCTGCCTGTGACCCCTAGATTCTTGAAGAAGAAGATGAGGAGGAGGATG
TTAATTGGGACGAGGATGATACTGTTGACAATTTTGATAGGGCTACTTACTCTGATGGTT
CTGGTGATGAGGACTTTTTACAAGAGATGTCCGAGAAAGATGAGAAAATCAAGTCCTTAG
TCAGCATGGGTTTTCCTGAAGATGAAGCAATGAGGGCTATTACTAGATGCGGTCTGGATG
CGTCTGTAGATTTGTTGGTTGAGTCAATCTATGCACCAGCATCTGCAGGAAATGTTTATT
TTACAAACTTATCTGACTATGAGGATACAGAGTTCAGTTCCTTTGGAGGAAGAAAGAAAA
CAAAATTAATAGATGGAACCAAGAAAAAAAGAGAACGGTATAGAAGTAGACCACAATGGA
ATCAAGTGCCATTTGACGGCAGCCATGAAGAGCCAATGCCTCTTCCAAATCCAATGGTGG
GATTCAGCTTGCCCAATGACGGGTTAAGGTCAGTCCACAGAAACCTTCCTGACCATGCTC
TTGGACCACCATTCTTTTACTATGAAAACGTGGCCCTAGCACCAAAAGGTGTATGGACGA
CCATCTCAAGGTTCTTGTATGACATTTATCCTGAGTTCGTAGATTCCAAATACTTCTGTG
CTGCTGCTAGGAAGAGGGGTTACATCCATAACTTGCCGATTGAGAACAGGTCACCTGTTC
TTCCCATTCCCCCAAAGACAATATCTGAAGCCTTTCCTTCTACTAAGATGTGGTGGCCCT
CTTGGGATCCAAGAAGGCAGTTCAACTGCTTGCAAACTTATGTGGCAAGCGCAAAGCATA
CAGAACGGATACGATGTGCTCTTGGTAGATTCGGTGATGCACTACCTCCAGCAGTTCAGA
AGAGTGTCTTGGAAGAATGTAGGAAGTGGAACCTTGTCTGGGTTGGAAAGAACAAGGTTG
CTACTCTAGAGCCTGATGAGATGGAATTCCTATTGGGATACCCTAGGAATCATACCAGGG
GAGTTAGCAGGAAGCGAGATATAGAGCTCTTGGGAATTCATTCCAAGTTGATACAGTTGC
ATACCACCTCTCTGTGCTGAGGGACATTTTCCCTAATGGCATGAACGTCTTGTCCTTGTT
TTCTGGTATTGGTGGAGCAGAAATAGCTCTCCACAAGCTTGGGATCCGTATGAAGACAGT
GGTCTCAGTCGAAATATCAGAGGTAAACATGGCGTTGCTGAGGAGTTGGTGGGACCAGAC
CCAAACTGGCATGCTGATTGAAATCGCAGATGTTCAAAATCTTACTGCTAAAAGAATTGA
ACTATTCATCAGAAGATTTGGTGGCTTTGACCTGGCGATCGGGGGCAGCCCGTGCAACAA
CCTCGCTGGTAGCAACAGATACCACCGTGATGGCTTGGAGGGCAAGCACTCAGCACTATT
CTATCACTACTACAGAATCTTGGATTCTGTAAAGACTATTATGGCTAGCATGTAAGCTA

CDS

1071 bp

>Os12t0108900-00 Similar to DRM-type DNA-methyltransferase.
ATTCTTGAAGAAGAAGATGAGGAGGAGGATGTTAATTGGGACGAGGATGATACTGTTGAC
AATTTTGATAGGGCTACTTACTCTGATGGTTCTGGTGATGAGGACTTTTTACAAGAGATG
TCCGAGAAAGATGAGAAAATCAAGTCCTTAGTCAGCATGGGTTTTCCTGAAGATGAAGCA
ATGAGGGCTATTACTAGATGCGGTCTGGATGCGTCTGTAGATTTGTTGGTTGAGTCAATC
TATGCACCAGCATCTGCAGGAAATGTTTATTTTACAAACTTATCTGACTATGAGGATACA
GAGTTCAGTTCCTTTGGAGGAAGAAAGAAAACAAAATTAATAGATGGAACCAAGAAAAAA
AGAGAACGGTATAGAAGTAGACCACAATGGAATCAAGTGCCATTTGACGGCAGCCATGAA
GAGCCAATGCCTCTTCCAAATCCAATGGTGGGATTCAGCTTGCCCAATGACGGGTTAAGG
TCAGTCCACAGAAACCTTCCTGACCATGCTCTTGGACCACCATTCTTTTACTATGAAAAC
GTGGCCCTAGCACCAAAAGGTGTATGGACGACCATCTCAAGGTTCTTGTATGACATTTAT
CCTGAGTTCGTAGATTCCAAATACTTCTGTGCTGCTGCTAGGAAGAGGGGTTACATCCAT
AACTTGCCGATTGAGAACAGGTCACCTGTTCTTCCCATTCCCCCAAAGACAATATCTGAA
GCCTTTCCTTCTACTAAGATGTGGTGGCCCTCTTGGGATCCAAGAAGGCAGTTCAACTGC
TTGCAAACTTATGTGGCAAGCGCAAAGCATACAGAACGGATACGATGTGCTCTTGGTAGA
TTCGGTGATGCACTACCTCCAGCAGTTCAGAAGAGTGTCTTGGAAGAATGTAGGAAGTGG
AACCTTGTCTGGGTTGGAAAGAACAAGGTTGCTACTCTAGAGCCTGATGAGATGGAATTC
CTATTGGGATACCCTAGGAATCATACCAGGGGAGTTAGCAGGAAGCGAGATATAGAGCTC
TTGGGAATTCATTCCAAGTTGATACAGTTGCATACCACCTCTCTGTGCTGA

Protein

357 aa

>Os12t0108900-00 Similar to DRM-type DNA-methyltransferase.
ILEEEDEEEDVNWDEDDTVDNFDRATYSDGSGDEDFLQEMSEKDEKIKSLVSMGFPEDEA
MRAITRCGLDASVDLLVESIYAPASAGNVYFTNLSDYEDTEFSSFGGRKKTKLIDGTKKK
RERYRSRPQWNQVPFDGSHEEPMPLPNPMVGFSLPNDGLRSVHRNLPDHALGPPFFYYEN
VALAPKGVWTTISRFLYDIYPEFVDSKYFCAAARKRGYIHNLPIENRSPVLPIPPKTISE
AFPSTKMWWPSWDPRRQFNCLQTYVASAKHTERIRCALGRFGDALPPAVQKSVLEECRKW
NLVWVGKNKVATLEPDEMEFLLGYPRNHTRGVSRKRDIELLGIHSKLIQLHTTSLC*

5'UTR

chr12:483967..484086 (+ strand) : 120 bp

chr12:484153..484304 (+ strand) : 152 bp

chr12:484446..484502 (+ strand) : 57 bp

CDS

chr12:484503..484604 (+ strand) : 102 bp

chr12:485601..485700 (+ strand) : 100 bp

chr12:485775..485866 (+ strand) : 92 bp

chr12:485962..486738 (+ strand) : 777 bp

3'UTR

chr12:486739..487137 (+ strand) : 399 bp

FASTA

>Os12t0108900-00 class=Sequence position=chr12:483967..487137 (+ strand)
GGACTGGGCT AGCGACAACG ATGAGgatag cgagttcgag tgggatactg atggtgagtt tgaggcctcg tctgctccag
ccttttcgaa cacggatgca cctggtctgt ccacgagCTG GTCATTTGTT TAAACCATGA TATTACCTTG CTATAATTAT
AATCATAATA TGGTGTTTGT CTAAAGGATG CTAATGGGAA GGCCAATGGA TCAGCACCAT CAGCTTTGGT GGCTTACTTT
TTGGGAATGG GTTTCTCGAG AGAGATGGTC TTCAGAGCTA TCAAGGAGAT TGGTAATGAT AACAATAATA CATTTCCTCA
TTTGCTTCAA CTGTTGCCGT TTCTTTCAGG GGACACAGAT TCGGAGCAAA TTCTTGAGTT ACTTCTCACT TATCAGGTAT
TTGTTCACGT GGTTGCATCA CTTTGTTTAT TATCTAATGC TCTATTGTAC AAGTCATGTT GTGTAATACT GTAATGCAGG
CGATAGGCAG TGACCCTTCA GTGGGTAACA GCTCTCATTC TGCCTGTGAC CCCTAGATTC TTGAAGAAGA AGATGAGGAG
GAGGATGTTA ATTGGGACGA GGATGATACT GTTGACAATT TTGATAGGGC TACTTACTCT GATGGTTCTG GTGATGAGGT
ATGCACATGA CTCCCTCCTT GGTCATTATA TATTTATATC AGATACTTGT TGTGTCTATT TCTCGACCAA TTTACCTGAT
CATGATCAAA CCTTTGTTAT ACTTGTTTCA TGCCAAGCAC ACATTCCCTT TTAGTGCTTG TCTAAATGAT CTATTGGTCC
AATAAATTGG AAGGTTTTGT GACTTAAGTT ATGTTTCACT TTTATTTAGT AAACTAGTGT ACATGCTTAC CTGTACTGCA
ATACTATAGT TTTTTTGGGT TATCTATAAA ACAGTACCTG TTCCTGTAGG GTTGTTAAAG GAGCTTTGTT GATCCTGCTC
TTACTTCTAT GTTTCTTTAG CTGGCATTTT TGTATGGTGC CTTTATAGTG AGGGAGAGTT AGCAGAACTA CTACAGGACC
ATCAAAGAAA TGATCATATA CTTCTACAAG GTCGTATTCA AACCAAGCAA TGATGAAAGA TAGTCTACTG GATGCCTATA
ATTGAATGGT TGCAAGTTAA GACCACCAGA CAGAACAATG ATAACCACTG GCTACATCTG AACACATAAT AGACAACAAA
AAATAGAACT GAAATGATGC CTATGAGAGC TTAGGTAATC TGTGCTGGGC ATTTATCCAT GTGTTGATGA TTGATAAGCT
GTACTCCCCC TCCTTTTTGT GGCCTAACAG GCTTTCTTGT TTCACCATTT TTTGAATAGT TTTACTACTT TTTCATTACA
TATTTAGTAT GAGTTTCCTC TAACTTTAAT CCTCAAAATA AGTTCCTCTA TAGTGTGGTA GTATCTGTTT GCATGGAGTT
GTAAGACGCA ACAACAAATT TGACACAGAA GGATAATCGT ATATTTTGTT GCAGTAAATT TGGGTTTTAC AAATGGTACA
TGCATATATG TGATGCCTGC ATTAGTTGCT TTGTTGGGAG GTTATTTCAG ACTGCAATTC ATGAGTGAGA TGTAGCAAAT
GTTTTCAGTC TGCTTGTAAT GTGCTTTGTT GCAGGACTTT TTACAAGAGA TGTCCGAGAA AGATGAGAAA ATCAAGTCCT
TAGTCAGCAT GGGTTTTCCT GAAGATGAAG CAATGAGGGC TATTACTAGA TGCGGTATAC CTCTATTGAA GTTGCTGCTT
TGACAGTAAG GAGCCTTATA CTGCCTATGC TGGGTTAAAT TTTGGCAGGT CTGGATGCGT CTGTAGATTT GTTGGTTGAG
TCAATCTATG CACCAGCATC TGCAGGAAAT GTTTATTTTA CAAACTTATC TGACTATGAG GTATGGGTAC CTTGTGATTA
TAGAGCATCT GAATGATGAA ATTGTTTTCA TTTCTTTAAT GTAATGCCAC TGGCATAATG TTTACTTTTG TGCAGGATAC
AGAGTTCAGT TCCTTTGGAG GAAGAAAGAA AACAAAATTA ATAGATGGAA CCAAGAAAAA AAGAGAACGG TATAGAAGTA
GACCACAATG GAATCAAGTG CCATTTGACG GCAGCCATGA AGAGCCAATG CCTCTTCCAA ATCCAATGGT GGGATTCAGC
TTGCCCAATG ACGGGTTAAG GTCAGTCCAC AGAAACCTTC CTGACCATGC TCTTGGACCA CCATTCTTTT ACTATGAAAA
CGTGGCCCTA GCACCAAAAG GTGTATGGAC GACCATCTCA AGGTTCTTGT ATGACATTTA TCCTGAGTTC GTAGATTCCA
AATACTTCTG TGCTGCTGCT AGGAAGAGGG GTTACATCCA TAACTTGCCG ATTGAGAACA GGTCACCTGT TCTTCCCATT
CCCCCAAAGA CAATATCTGA AGCCTTTCCT TCTACTAAGA TGTGGTGGCC CTCTTGGGAT CCAAGAAGGC AGTTCAACTG
CTTGCAAACT TATGTGGCAA GCGCAAAGCA TACAGAACGG ATACGATGTG CTCTTGGTAG ATTCGGTGAT GCACTACCTC
CAGCAGTTCA GAAGAGTGTC TTGGAAGAAT GTAGGAAGTG GAACCTTGTC TGGGTTGGAA AGAACAAGGT TGCTACTCTA
GAGCCTGATG AGATGGAATT CCTATTGGGA TACCCTAGGA ATCATACCAG GGGAGTTAGC AGGAAGCGAG ATATAGAGCT
CTTGGGAATT CATTCCAAGT TGATACAGTT GCATACCACC TCTCTGTGCT GAGGGACATT TTCCCTAATG GCATGAACGT
CTTGTCCTTG TTTTCTGGTA TTGGTGGAGC AGAAATAGCT CTCCACAAGC TTGGGATCCG TATGAAGACA GTGGTCTCAG
TCGAAATATC AGAGGTAAAC ATGGCGTTGC TGAGGAGTTG GTGGGACCAG ACCCAAACTG GCATGCTGAT TGAAATCGCA
GATGTTCAAA ATCTTACTGC TAAAAGAATT GAACTATTCA TCAGAAGATT TGGTGGCTTT GACCTGGCGA TCGGGGGCAG
CCCGTGCAAC AACCTCGCTG GTAGCAACAG ATACCACCGT GATGGCTTGG AGGGCAAGCA CTCAGCACTA TTCTATCACT
ACTACAGAAT CTTGGATTCT GTAAAGACTA TTATGGCTAG CATGTAAGCT A

Locus: Os12g0108900

Loading...

Locus: Os12g0108900

Loading...