Os12t0113500-01

Locus

Os12g0113500

Description

Similar to CBL-interacting protein kinase 14.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CIPK14

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 14

Oryzabase Gene Symbol Synonym(s)

OsCIPK14

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 14

Transcript Evidence

AK242733 (DDBJ, Best hit)

AK243050 (DDBJ, Best hit)

Protein Evidence

Q2QYM3 (UniProt)

Literature

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Full-length cDNA

J090047O22 (Online Clone Ordering)

J100011E04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0113500-01)

Others

Oryzabase (7401)

Transcript

2028 bp

>Os12t0113500-01 Similar to CBL-interacting protein kinase 14.
GCATCCACTCCACATACTACCACTCAAAAACTCTCTCTCTCTACCCAAACAGGTTTTGAG
AAAGAAGTGGAGGACAGATCCAAAAAGTTCACCTTTTGATTATCCAAACAAGTTTGGAGT
TTGTTACCTGAATCTCCTCTTCTTCCTGTCACCGGAAGGGAAATTGATAAAAAAAAAGCA
GTGAAAGCCTCAAGGAATGCTGAAAGATGTGCTTGCATAGAAGAAATTTTCCGTGTGAGA
TAAAGCAGATTGCTGGTTCACTAGTGCTACTGATCTGCTCAAGTCTTGATGTGAGTGATC
AACTTTCCTGCACTAATTCTACACCATTTAGACTCCGAAACGACGATGATATAAGAATGT
TGTTCTCCATTCATGATCATGACCTTGGGGAGGATGGCTAAAGAATTGCAGTCCATCTGA
TTGGTGGTCAAAACATAGTGCTGAGATTTATATCTTTGTGGGCATGGAGAGTAGAGGGAA
GATACTAATGGAGAGGTATGAGTTGGGCAGATTGTTGGGGAAAGGAACATTTGGCAAGGT
GCACTATGCAAGGAATCTGGAGTCAAACCAGAGTGTGGCCATAAAGATGATGGACAAACA
GCAGGTGTTGAAGGTCGGGCTTTCGGAGCAGATCAGACGTGAGATCACAACCATGCGGTT
GGTGGCTCATAAGAACATTGTTCAGCTTCATGAGGTCATGGCAACACGGAACAAGATCTA
CTTTGTGATGGAGTATGTGAAAGGTGGTGAGCTATTTGAAAAGGTTGCAAAGCGTGGAAA
GCTTACAGAGGTTGTTGCACATAAGTACTTCCAGCAACTCATTAGTGCAGTGGATTACTG
CCACAGTCGAGGTGTGTATCACCGGGACTTGAAGCCTGAAAACCTGCTGTTGGATGAGAA
TGAGAACCTGAAAGTCTCAGACTTTGGACTGAGTGCGCTTTCAGAGTCGAAGAGGCAAGA
TGGCTTACTCCATACCACCTGTGGAACACCTGCATATGTAGCTCCAGAGGTGATCAGCAA
GATAGGATATGATGGTGCAAAGTCAGATATTTGGTCTTGTGGTGTTATCCTGTTTGTTCT
TGTTGCTGGTTACCTTCCTTTCCAGGGCCCAAACTTGATGGAAATGTATCGGAAGATACA
ACATGGTGAATTCAGGTGCCCCGGTTGGTTTTCACGCAAACTTCAGAAGTTGTTGTACAA
GATCATGGACCCCAACCCAAGCACAAGGATTTCAATCCAGAAGATAAAGGAGTCTACCTG
GTTCCGGAAAGGTCCTGAGGAGAATCGTATTTTGAAGGAAAGAACTTTGAATGAAAACAC
CACCAAAAATGTTGCTCTGGTGCTTGGTGTGAGACGCAAGAAAAATGCTCATGAAGATGT
GAAGCCCATGTCAGTGACAAACTTAAATGCCTTTGAAATTATCTCTTTCTCCAAGGGGTT
TGATCTCTCTGGCATGTTCATTGTAAAGGAATGGAGAAATGAGGCAAGGTTCACTTCAGA
TAAATCTGCCTCAACCATAATCTCAAAGCTAGAAGATGTAGCAAAGGCGCTAAATCTCAG
GGTAAGGAAGAAAGACAATGGTGTAGTGAAGATGCAAGGGAGGAAGGAGGGAAGGAATGG
TGTTCTTCAGTTTGACATAGAGATATTTGAGGTTACCACTTCCTATCATATCATCGAGAT
GAAACAAACAAGTGGCGATTCATTGGAGTACCGACAGCTACTGGAGGAGGGCATCCGGCC
AGCTCTGAAGGACATTGTCTTGGCCTGGCATGGAGATGAATAGCAGCAGTCGCAAGAGTA
GATTTTGATGTCTCAAGCATTTAGTTTCCGCTCCTCAAATTCATTAGGTTTTAGCTCAAA
TGAATTTATTTGTCTTGCCTATGTTCTTTTTAGCATCTATGTTTTTGTATCTGGAGAGTT
CATGTTGAGGCAATCTATGCACAATTTAGATGGAGTCTGTCGAGAGTAATTTTATGAGAA
GTTGAGCTGCAATATAAAAGTTGGCTTTGAGCCTTTCAAGCTTTCTTC

CDS

1320 bp

>Os12t0113500-01 Similar to CBL-interacting protein kinase 14.
ATGGAGAGTAGAGGGAAGATACTAATGGAGAGGTATGAGTTGGGCAGATTGTTGGGGAAA
GGAACATTTGGCAAGGTGCACTATGCAAGGAATCTGGAGTCAAACCAGAGTGTGGCCATA
AAGATGATGGACAAACAGCAGGTGTTGAAGGTCGGGCTTTCGGAGCAGATCAGACGTGAG
ATCACAACCATGCGGTTGGTGGCTCATAAGAACATTGTTCAGCTTCATGAGGTCATGGCA
ACACGGAACAAGATCTACTTTGTGATGGAGTATGTGAAAGGTGGTGAGCTATTTGAAAAG
GTTGCAAAGCGTGGAAAGCTTACAGAGGTTGTTGCACATAAGTACTTCCAGCAACTCATT
AGTGCAGTGGATTACTGCCACAGTCGAGGTGTGTATCACCGGGACTTGAAGCCTGAAAAC
CTGCTGTTGGATGAGAATGAGAACCTGAAAGTCTCAGACTTTGGACTGAGTGCGCTTTCA
GAGTCGAAGAGGCAAGATGGCTTACTCCATACCACCTGTGGAACACCTGCATATGTAGCT
CCAGAGGTGATCAGCAAGATAGGATATGATGGTGCAAAGTCAGATATTTGGTCTTGTGGT
GTTATCCTGTTTGTTCTTGTTGCTGGTTACCTTCCTTTCCAGGGCCCAAACTTGATGGAA
ATGTATCGGAAGATACAACATGGTGAATTCAGGTGCCCCGGTTGGTTTTCACGCAAACTT
CAGAAGTTGTTGTACAAGATCATGGACCCCAACCCAAGCACAAGGATTTCAATCCAGAAG
ATAAAGGAGTCTACCTGGTTCCGGAAAGGTCCTGAGGAGAATCGTATTTTGAAGGAAAGA
ACTTTGAATGAAAACACCACCAAAAATGTTGCTCTGGTGCTTGGTGTGAGACGCAAGAAA
AATGCTCATGAAGATGTGAAGCCCATGTCAGTGACAAACTTAAATGCCTTTGAAATTATC
TCTTTCTCCAAGGGGTTTGATCTCTCTGGCATGTTCATTGTAAAGGAATGGAGAAATGAG
GCAAGGTTCACTTCAGATAAATCTGCCTCAACCATAATCTCAAAGCTAGAAGATGTAGCA
AAGGCGCTAAATCTCAGGGTAAGGAAGAAAGACAATGGTGTAGTGAAGATGCAAGGGAGG
AAGGAGGGAAGGAATGGTGTTCTTCAGTTTGACATAGAGATATTTGAGGTTACCACTTCC
TATCATATCATCGAGATGAAACAAACAAGTGGCGATTCATTGGAGTACCGACAGCTACTG
GAGGAGGGCATCCGGCCAGCTCTGAAGGACATTGTCTTGGCCTGGCATGGAGATGAATAG

Protein

440 aa

>Os12t0113500-01 Similar to CBL-interacting protein kinase 14.
MESRGKILMERYELGRLLGKGTFGKVHYARNLESNQSVAIKMMDKQQVLKVGLSEQIRRE
ITTMRLVAHKNIVQLHEVMATRNKIYFVMEYVKGGELFEKVAKRGKLTEVVAHKYFQQLI
SAVDYCHSRGVYHRDLKPENLLLDENENLKVSDFGLSALSESKRQDGLLHTTCGTPAYVA
PEVISKIGYDGAKSDIWSCGVILFVLVAGYLPFQGPNLMEMYRKIQHGEFRCPGWFSRKL
QKLLYKIMDPNPSTRISIQKIKESTWFRKGPEENRILKERTLNENTTKNVALVLGVRRKK
NAHEDVKPMSVTNLNAFEIISFSKGFDLSGMFIVKEWRNEARFTSDKSASTIISKLEDVA
KALNLRVRKKDNGVVKMQGRKEGRNGVLQFDIEIFEVTTSYHIIEMKQTSGDSLEYRQLL
EEGIRPALKDIVLAWHGDE*

5'UTR

chr12:681986..682143 (- strand) : 158 bp

chr12:680644..680948 (- strand) : 305 bp

CDS

chr12:679324..680643 (- strand) : 1320 bp

3'UTR

chr12:679079..679323 (- strand) : 245 bp

FASTA

>Os12t0113500-01 class=Sequence position=chr12:679079..682143 (- strand)
GCATCCACTC CACATACTAC CACTCAAAAA CTCTCTCTCT CTACCCAAAC AGGTTTTGAG AAAGAAGTGG AGGACAGATC
CAAAAAGTTC ACCTTTTGAT TATCCAAACA AGTTTGGAGT TTGTTACCTG AATCTCCTCT TCTTCCTGTC ACCGGAAGGT
ATGCAGTTCC TCTCTCCATA TCATCTTCTA GCGTTTCTTT CTACAGATTC TTGATTGCTC GCTTTTTTCC ATTATTCTCT
TTTGCTCCAA CGTAGGGGTA GGGCCACATC AGTTGGACAA GTAGAAATTG ATGGCACATC AATTGAGTAG ATGCGGAAAT
TTCTGGTTTT TAGTTAAAGT TTAGACCATG CCGATGCCAA AGTGCTGCCG TTTAATCGAA TACAACGATA TATACTCTTG
CAATGGCATG TGTCATGAGG TGTTTGGGTT TGGCGAGGCT CAGTTTTCAT TGAATTTCCC CTCCTTCCCA TGTGGCCGTA
TCAAGCCTAA TCTTTGAAAA ATATTCACTT CATGTGGATG CGGAATCACT AGATGCAGCT TGACTCCATG CAAATCCTAA
CTCCTGCCAT GTGCCCATGT GCCTGTCCCT TATCCTGATT TGCATCTGAA TTCATTTGCT CAGTAATTTG CTTGTTCAGT
GCCTAATCCG ATAGACGTCC AAACAAAGTT TTAATTAGGA GCAGAAGATC CAGCAATGTT ATTTTTTCTG AATTTGTAAT
GTCTTGGTTT CTGAATTCGT AATTGACTAT TTTTATTAAT CACCTTTCTG AACCTGAACG AAAGATGCAT AATGATTCAC
ATCGGTTGCA AATTTACTGA ATATTTCCTC TTATTTCTAG TGTGTTATTC ATAGAGTTCC GAAACTCAAT TTCCCTTTTT
TAAAAAAGCT TCTGATTTAC CATTCCAGAT TTCTGATAAG TACTTAGTTA AAGTTCCTTA TTATATTAAT TATCTATATT
ATCTATTACA CAACACGTTG AACTCATGTA AGTTCTGATT GATTATAGGG AACACTTATA TTATATAAGT AGTAGGTATA
ATTATATAAA AATGCAGTTA GTACTACAAT AAGCTTTCAA AATTCTTCGT AGTGACTTTT GTTTGGTTAA AGTTCTTACA
GACTTCCAGA TTATTATACG TACCTTGTTA GCGACATTCA ATTACTGAAT CTGATGCCTG GTTTTGTTTG TGCAGGGAAA
TTGATAAAAA AAAAGCAGTG AAAGCCTCAA GGAATGCTGA AAGATGTGCT TGCATAGAAG AAATTTTCCG TGTGAGATAA
AGCAGATTGC TGGTTCACTA GTGCTACTGA TCTGCTCAAG TCTTGATGTG AGTGATCAAC TTTCCTGCAC TAATTCTACA
CCATTTAGAC TCCGAAACGA CGATGATATA AGAATGTTGT TCTCCATTCA TGATCATGAC CTTGGGGAGG ATGGCTAAAG
AATTGCAGTC CATCTGATTG GTGGTCAAAA CATAGTGCTG AGATTTATAT CTTTGTGGGC ATGGAGAGTA GAGGGAAGAT
ACTAATGGAG AGGTATGAGT TGGGCAGATT GTTGGGGAAA GGAACATTTG GCAAGGTGCA CTATGCAAGG AATCTGGAGT
CAAACCAGAG TGTGGCCATA AAGATGATGG ACAAACAGCA GGTGTTGAAG GTCGGGCTTT CGGAGCAGAT CAGACGTGAG
ATCACAACCA TGCGGTTGGT GGCTCATAAG AACATTGTTC AGCTTCATGA GGTCATGGCA ACACGGAACA AGATCTACTT
TGTGATGGAG TATGTGAAAG GTGGTGAGCT ATTTGAAAAG GTTGCAAAGC GTGGAAAGCT TACAGAGGTT GTTGCACATA
AGTACTTCCA GCAACTCATT AGTGCAGTGG ATTACTGCCA CAGTCGAGGT GTGTATCACC GGGACTTGAA GCCTGAAAAC
CTGCTGTTGG ATGAGAATGA GAACCTGAAA GTCTCAGACT TTGGACTGAG TGCGCTTTCA GAGTCGAAGA GGCAAGATGG
CTTACTCCAT ACCACCTGTG GAACACCTGC ATATGTAGCT CCAGAGGTGA TCAGCAAGAT AGGATATGAT GGTGCAAAGT
CAGATATTTG GTCTTGTGGT GTTATCCTGT TTGTTCTTGT TGCTGGTTAC CTTCCTTTCC AGGGCCCAAA CTTGATGGAA
ATGTATCGGA AGATACAACA TGGTGAATTC AGGTGCCCCG GTTGGTTTTC ACGCAAACTT CAGAAGTTGT TGTACAAGAT
CATGGACCCC AACCCAAGCA CAAGGATTTC AATCCAGAAG ATAAAGGAGT CTACCTGGTT CCGGAAAGGT CCTGAGGAGA
ATCGTATTTT GAAGGAAAGA ACTTTGAATG AAAACACCAC CAAAAATGTT GCTCTGGTGC TTGGTGTGAG ACGCAAGAAA
AATGCTCATG AAGATGTGAA GCCCATGTCA GTGACAAACT TAAATGCCTT TGAAATTATC TCTTTCTCCA AGGGGTTTGA
TCTCTCTGGC ATGTTCATTG TAAAGGAATG GAGAAATGAG GCAAGGTTCA CTTCAGATAA ATCTGCCTCA ACCATAATCT
CAAAGCTAGA AGATGTAGCA AAGGCGCTAA ATCTCAGGGT AAGGAAGAAA GACAATGGTG TAGTGAAGAT GCAAGGGAGG
AAGGAGGGAA GGAATGGTGT TCTTCAGTTT GACATAGAGA TATTTGAGGT TACCACTTCC TATCATATCA TCGAGATGAA
ACAAACAAGT GGCGATTCAT TGGAGTACCG ACAGCTACTG GAGGAGGGCA TCCGGCCAGC TCTGAAGGAC ATTGTCTTGG
CCTGGCATGG AGATGAATAG CAGCAGTCGC AAGAGTAGAT TTTGATGTCT CAAGCATTTA GTTTCCGCTC CTCAAATTCA
TTAGGTTTTA GCTCAAATGA ATTTATTTGT CTTGCCTATG TTCTTTTTAG CATCTATGTT TTTGTATCTG GAGAGTTCAT
GTTGAGGCAA TCTATGCACA ATTTAGATGG AGTCTGTCGA GAGTAATTTT ATGAGAAGTT GAGCTGCAAT ATAAAAGTTG
GCTTTGAGCC TTTCAAGCTT TCTTC

Locus: Os12g0113500

Loading...

Locus: Os12g0113500

Loading...