Os12t0113500-02

Locus

Os12g0113500

Description

Serine/threonine protein kinase, Microbe-assosiated molecular pattern (MAMP)-induced defense signaling pathway

RAP-DB Gene Symbol Synonym(s)

CIPK14, OsCIPK14

RAP-DB Gene Name Synonym(s)

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 14, Oryza sativa calcineurin B-like (CBL) protein-interacting protein kinase 14, CBL-interacting protein kinase 14

CGSNL Gene Symbol

CIPK14

CGSNL Gene Name

CALCINEURIN B-LIKE PROTEIN-INTERACTING PROTEIN KINASE 14

Oryzabase Gene Symbol Synonym(s)

OsCIPK14

Oryzabase Gene Name Synonym(s)

CBL-interacting protein kinase 14

Transcript Evidence

AB264036 (DDBJ)

Protein Evidence

Q2QYM3 (UniProt)

Literature

PMID: 17535819

PMID: 20357140

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

July 12, 2010

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: signal transduction (GO:0007165)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Kinase-associated KA1 (IPR001772)

Serine/threonine- / dual-specificity protein kinase, catalytic domain (IPR002290)

NAF domain (IPR004041)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

NAF/FISL domain (IPR018451)

Expression Databases

TENOR (Os12t0113500-02)

Others

Oryzabase (7401)

Transcript

1872 bp

>Os12t0113500-02 Serine/threonine protein kinase, Microbe-assosiated molecular pattern (MAMP)-induced defense signaling pathway
AGGGAAATTGATAAAAAAAAAGCAGTGAAAGCCTCAAGGAATGCTGAAAGATGTGCTTGC
ATAGAAGAAATTTTCCGTGTGAGATAAAGCAGATTGCTGGTTCACTAGTGCTACTGATCT
GCTCAAGTCTTGATGTGAGTGATCAACTTTCCTGCACTAATTCTACACCATTTAGACTCC
GAAACGACGATGATATAAGAATGTTGTTCTCCATTCATGATCATGACCTTGGGGAGGATG
GCTAAAGAATTGCAGTCCATCTGATTGGTGGTCAAAACATAGTGCTGAGATTTATATCTT
TGTGGGCATGGAGAGTAGAGGGAAGATACTAATGGAGAGGTATGAGTTGGGCAGATTGTT
GGGGAAAGGAACATTTGGCAAGGTGCACTATGCAAGGAATCTGGAGTCAAACCAGAGTGT
GGCCATAAAGATGATGGACAAACAGCAGGTGTTGAAGGTCGGGCTTTCGGAGCAGATCAG
ACGTGAGATCACAACCATGCGGTTGGTGGCTCATAAGAACATTGTTCAGCTTCATGAGGT
CATGGCAACACGGAACAAGATCTACTTTGTGATGGAGTATGTGAAAGGTGGTGAGCTATT
TGAAAAGGTTGCAAAGCGTGGAAAGCTTACAGAGGTTGTTGCACATAAGTACTTCCAGCA
ACTCATTAGTGCAGTGGATTACTGCCACAGTCGAGGTGTGTATCACCGGGACTTGAAGCC
TGAAAACCTGCTGTTGGATGAGAATGAGAACCTGAAAGTCTCAGACTTTGGACTGAGTGC
GCTTTCAGAGTCGAAGAGGCAAGATGGCTTACTCCATACCACCTGTGGAACACCTGCATA
TGTAGCTCCAGAGGTGATCAGCAAGATAGGATATGATGGTGCAAAGTCAGATATTTGGTC
TTGTGGTGTTATCCTGTTTGTTCTTGTTGCTGGTTACCTTCCTTTCCAGGGCCCAAACTT
GATGGAAATGTATCGGAAGATACAACATGGTGAATTCAGGTGCCCCGGTTGGTTTTCACG
CAAACTTCAGAAGTTGTTGTACAAGATCATGGACCCCAACCCAAGCACAAGGATTTCAAT
CCAGAAGATAAAGGAGTCTACCTGGTTCCGGAAAGGTCCTGAGGAGAATCGTATTTTGAA
GGAAAGAACTTTGAATGAAAACACCACCAAAAATGTTGCTCTGGTGCTTGGTGTGAGACG
CAAGAAAAATGCTCATGAAGATGTGAAGCCCATGTCAGTGACAAACTTAAATGCCTTTGA
AATTATCTCTTTCTCCAAGGGGTTTGATCTCTCTGGCATGTTCATTGTAAAGGAATGGAG
AAATGAGGCAAGGTTCACTTCAGATAAATCTGCCTCAACCATAATCTCAAAGCTAGAAGA
TGTAGCAAAGGCGCTAAATCTCAGGGTAAGGAAGAAAGACAATGGTGTAGTGAAGATGCA
AGGGAGGAAGGAGGGAAGGAATGGTGTTCTTCAGTTTGACATAGAGATATTTGAGGTTAC
CACTTCCTATCATATCATCGAGATGAAACAAACAAGTGGCGATTCATTGGAGTACCGACA
GCTACTGGAGGAGGGCATCCGGCCAGCTCTGAAGGACATTGTCTTGGCCTGGCATGGAGA
TGAATAGCAGCAGTCGCAAGAGTAGATTTTGATGTCTCAAGCATTTAGTTTCCGCTCCTC
AAATTCATTAGGTTTTAGCTCAAATGAATTTATTTGTCTTGCCTATGTTCTTTTTAGCAT
CTATGTTTTTGTATCTGGAGAGTTCATGTTGAGGCAATCTATGCACAATTTAGATGGAGT
CTGTCGAGAGTAATTTTATGAGAAGTTGAGCTGCAATATAAAAGTTGGCTTTGAGCCTTT
CAAGCTTTCTTC

CDS

1320 bp

>Os12t0113500-02 Serine/threonine protein kinase, Microbe-assosiated molecular pattern (MAMP)-induced defense signaling pathway
ATGGAGAGTAGAGGGAAGATACTAATGGAGAGGTATGAGTTGGGCAGATTGTTGGGGAAA
GGAACATTTGGCAAGGTGCACTATGCAAGGAATCTGGAGTCAAACCAGAGTGTGGCCATA
AAGATGATGGACAAACAGCAGGTGTTGAAGGTCGGGCTTTCGGAGCAGATCAGACGTGAG
ATCACAACCATGCGGTTGGTGGCTCATAAGAACATTGTTCAGCTTCATGAGGTCATGGCA
ACACGGAACAAGATCTACTTTGTGATGGAGTATGTGAAAGGTGGTGAGCTATTTGAAAAG
GTTGCAAAGCGTGGAAAGCTTACAGAGGTTGTTGCACATAAGTACTTCCAGCAACTCATT
AGTGCAGTGGATTACTGCCACAGTCGAGGTGTGTATCACCGGGACTTGAAGCCTGAAAAC
CTGCTGTTGGATGAGAATGAGAACCTGAAAGTCTCAGACTTTGGACTGAGTGCGCTTTCA
GAGTCGAAGAGGCAAGATGGCTTACTCCATACCACCTGTGGAACACCTGCATATGTAGCT
CCAGAGGTGATCAGCAAGATAGGATATGATGGTGCAAAGTCAGATATTTGGTCTTGTGGT
GTTATCCTGTTTGTTCTTGTTGCTGGTTACCTTCCTTTCCAGGGCCCAAACTTGATGGAA
ATGTATCGGAAGATACAACATGGTGAATTCAGGTGCCCCGGTTGGTTTTCACGCAAACTT
CAGAAGTTGTTGTACAAGATCATGGACCCCAACCCAAGCACAAGGATTTCAATCCAGAAG
ATAAAGGAGTCTACCTGGTTCCGGAAAGGTCCTGAGGAGAATCGTATTTTGAAGGAAAGA
ACTTTGAATGAAAACACCACCAAAAATGTTGCTCTGGTGCTTGGTGTGAGACGCAAGAAA
AATGCTCATGAAGATGTGAAGCCCATGTCAGTGACAAACTTAAATGCCTTTGAAATTATC
TCTTTCTCCAAGGGGTTTGATCTCTCTGGCATGTTCATTGTAAAGGAATGGAGAAATGAG
GCAAGGTTCACTTCAGATAAATCTGCCTCAACCATAATCTCAAAGCTAGAAGATGTAGCA
AAGGCGCTAAATCTCAGGGTAAGGAAGAAAGACAATGGTGTAGTGAAGATGCAAGGGAGG
AAGGAGGGAAGGAATGGTGTTCTTCAGTTTGACATAGAGATATTTGAGGTTACCACTTCC
TATCATATCATCGAGATGAAACAAACAAGTGGCGATTCATTGGAGTACCGACAGCTACTG
GAGGAGGGCATCCGGCCAGCTCTGAAGGACATTGTCTTGGCCTGGCATGGAGATGAATAG

Protein

440 aa

>Os12t0113500-02 Serine/threonine protein kinase, Microbe-assosiated molecular pattern (MAMP)-induced defense signaling pathway
MESRGKILMERYELGRLLGKGTFGKVHYARNLESNQSVAIKMMDKQQVLKVGLSEQIRRE
ITTMRLVAHKNIVQLHEVMATRNKIYFVMEYVKGGELFEKVAKRGKLTEVVAHKYFQQLI
SAVDYCHSRGVYHRDLKPENLLLDENENLKVSDFGLSALSESKRQDGLLHTTCGTPAYVA
PEVISKIGYDGAKSDIWSCGVILFVLVAGYLPFQGPNLMEMYRKIQHGEFRCPGWFSRKL
QKLLYKIMDPNPSTRISIQKIKESTWFRKGPEENRILKERTLNENTTKNVALVLGVRRKK
NAHEDVKPMSVTNLNAFEIISFSKGFDLSGMFIVKEWRNEARFTSDKSASTIISKLEDVA
KALNLRVRKKDNGVVKMQGRKEGRNGVLQFDIEIFEVTTSYHIIEMKQTSGDSLEYRQLL
EEGIRPALKDIVLAWHGDE*

5'UTR

chr12:680644..680950 (- strand) : 307 bp

CDS

chr12:679324..680643 (- strand) : 1320 bp

3'UTR

chr12:679079..679323 (- strand) : 245 bp

FASTA

>Os12t0113500-02 class=Sequence position=chr12:679079..680950 (- strand)
AGGGAAATTG ATAAAAAAAA AGCAGTGAAA GCCTCAAGGA ATGCTGAAAG ATGTGCTTGC ATAGAAGAAA TTTTCCGTGT
GAGATAAAGC AGATTGCTGG TTCACTAGTG CTACTGATCT GCTCAAGTCT TGATGTGAGT GATCAACTTT CCTGCACTAA
TTCTACACCA TTTAGACTCC GAAACGACGA TGATATAAGA ATGTTGTTCT CCATTCATGA TCATGACCTT GGGGAGGATG
GCTAAAGAAT TGCAGTCCAT CTGATTGGTG GTCAAAACAT AGTGCTGAGA TTTATATCTT TGTGGGCATG GAGAGTAGAG
GGAAGATACT AATGGAGAGG TATGAGTTGG GCAGATTGTT GGGGAAAGGA ACATTTGGCA AGGTGCACTA TGCAAGGAAT
CTGGAGTCAA ACCAGAGTGT GGCCATAAAG ATGATGGACA AACAGCAGGT GTTGAAGGTC GGGCTTTCGG AGCAGATCAG
ACGTGAGATC ACAACCATGC GGTTGGTGGC TCATAAGAAC ATTGTTCAGC TTCATGAGGT CATGGCAACA CGGAACAAGA
TCTACTTTGT GATGGAGTAT GTGAAAGGTG GTGAGCTATT TGAAAAGGTT GCAAAGCGTG GAAAGCTTAC AGAGGTTGTT
GCACATAAGT ACTTCCAGCA ACTCATTAGT GCAGTGGATT ACTGCCACAG TCGAGGTGTG TATCACCGGG ACTTGAAGCC
TGAAAACCTG CTGTTGGATG AGAATGAGAA CCTGAAAGTC TCAGACTTTG GACTGAGTGC GCTTTCAGAG TCGAAGAGGC
AAGATGGCTT ACTCCATACC ACCTGTGGAA CACCTGCATA TGTAGCTCCA GAGGTGATCA GCAAGATAGG ATATGATGGT
GCAAAGTCAG ATATTTGGTC TTGTGGTGTT ATCCTGTTTG TTCTTGTTGC TGGTTACCTT CCTTTCCAGG GCCCAAACTT
GATGGAAATG TATCGGAAGA TACAACATGG TGAATTCAGG TGCCCCGGTT GGTTTTCACG CAAACTTCAG AAGTTGTTGT
ACAAGATCAT GGACCCCAAC CCAAGCACAA GGATTTCAAT CCAGAAGATA AAGGAGTCTA CCTGGTTCCG GAAAGGTCCT
GAGGAGAATC GTATTTTGAA GGAAAGAACT TTGAATGAAA ACACCACCAA AAATGTTGCT CTGGTGCTTG GTGTGAGACG
CAAGAAAAAT GCTCATGAAG ATGTGAAGCC CATGTCAGTG ACAAACTTAA ATGCCTTTGA AATTATCTCT TTCTCCAAGG
GGTTTGATCT CTCTGGCATG TTCATTGTAA AGGAATGGAG AAATGAGGCA AGGTTCACTT CAGATAAATC TGCCTCAACC
ATAATCTCAA AGCTAGAAGA TGTAGCAAAG GCGCTAAATC TCAGGGTAAG GAAGAAAGAC AATGGTGTAG TGAAGATGCA
AGGGAGGAAG GAGGGAAGGA ATGGTGTTCT TCAGTTTGAC ATAGAGATAT TTGAGGTTAC CACTTCCTAT CATATCATCG
AGATGAAACA AACAAGTGGC GATTCATTGG AGTACCGACA GCTACTGGAG GAGGGCATCC GGCCAGCTCT GAAGGACATT
GTCTTGGCCT GGCATGGAGA TGAATAGCAG CAGTCGCAAG AGTAGATTTT GATGTCTCAA GCATTTAGTT TCCGCTCCTC
AAATTCATTA GGTTTTAGCT CAAATGAATT TATTTGTCTT GCCTATGTTC TTTTTAGCAT CTATGTTTTT GTATCTGGAG
AGTTCATGTT GAGGCAATCT ATGCACAATT TAGATGGAGT CTGTCGAGAG TAATTTTATG AGAAGTTGAG CTGCAATATA
AAAGTTGGCT TTGAGCCTTT CAAGCTTTCT TC

Locus: Os12g0113500

Loading...

Locus: Os12g0113500

Loading...