Os12t0114500-01

Locus

Os12g0114500

Description

Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.15, OsLtpI.15

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.15, lipid transfer protein 1.15, type 1 non-specific lipid transfer protein 15

Transcript Evidence

AK073466 (DDBJ, Best hit)

AK104981 (DDBJ, Best hit)

Protein Evidence

A2ZHE8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J033044B21 (Online Clone Ordering)

001-125-E10 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0114500-01)

RiceXPro (AK073466)

Others

Oryzabase (13524)

KEGG (Os12t0114500-01)

Transcript

791 bp

>Os12t0114500-01 Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
CACCCACACCACACTCCACTCCAGCATAGTACTGCGCTTAGCTAATTAAGCAGCAACTTA
ACTTGATCTTCGTGTGACCGATCGATGGCTCGCGCGGCGAATAATAAGTATGTGGCGGCG
GTGATGGTGGTGGCGCTGCTGTTGGCGGCGCCGGCGGCGAGCGCGGTGACATGCGGGCAG
GTGGTGAGCATGCTGGCGCCGTGCATCATGTACGCGACGGGGAGGGTGTCCGCCCCCACC
GGCGGctgctgcgacggggtcaggaccctcaactccgccgccgccaccaccgccgaccgc
cagaccacctgcgcctgcctcaagcagcagaccagcgccatgggcggcctgaggcccgac
ctcgtcgccggcaTCCCCTCCAAGTGCGGCGTCAACATCCCCTACGCTATCAGCCCTTCC
ACCGACTGCTCCAGGGTGCACTGAGTGGATCAACGTCAAGTGATGCCACAATAATAATGG
AGAGATGGATCCATCGATCTGCGGCTCTCATTTTGCGGTTGCTATCTGCAATATTCGTCG
TCGTCAGAGAGATCGAGCTAGAAATGCATGTTACTCCTCCGTTCTGTTACTATCTGCTTA
CCTGTTGCTTCGTCGCGGTTTGATAGTCGTCGTTATAGCTAGTGTAAGAGTGTGAGGGTT
GATTTTGATCTGTCTCCTTTACGGGACGAGGGGCAGACGAATCATGCATGAATCTTAGAG
GACCTGCTTGCATTGTACCTTACTGCATGCATGCATGCTTCAATATATATCCATCAAATG
AAGAGTCTTTT

CDS

360 bp

>Os12t0114500-01 Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
ATGGCTCGCGCGGCGAATAATAAGTATGTGGCGGCGGTGATGGTGGTGGCGCTGCTGTTG
GCGGCGCCGGCGGCGAGCGCGGTGACATGCGGGCAGGTGGTGAGCATGCTGGCGCCGTGC
ATCATGTACGCGACGGGGAGGGTGTCCGCCCCCACCGGCGGctgctgcgacggggtcagg
accctcaactccgccgccgccaccaccgccgaccgccagaccacctgcgcctgcctcaag
cagcagaccagcgccatgggcggcctgaggcccgacctcgtcgccggcaTCCCCTCCAAG
TGCGGCGTCAACATCCCCTACGCTATCAGCCCTTCCACCGACTGCTCCAGGGTGCACTGA

Protein

120 aa

>Os12t0114500-01 Similar to Nonspecific lipid-transfer protein (LTP) (Fragment).
MARAANNKYVAAVMVVALLLAAPAASAVTCGQVVSMLAPCIMYATGRVSAPTGGCCDGVR
TLNSAAATTADRQTTCACLKQQTSAMGGLRPDLVAGIPSKCGVNIPYAISPSTDCSRVH*

5'UTR

chr12:723297..723380 (+ strand) : 84 bp

CDS

chr12:723381..723730 (+ strand) : 350 bp

chr12:723864..723873 (+ strand) : 10 bp

3'UTR

chr12:723874..724220 (+ strand) : 347 bp

FASTA

>Os12t0114500-01 class=Sequence position=chr12:723297..724220 (+ strand)
CACCCACACC ACACTCCACT CCAGCATAGT ACTGCGCTTA GCTAATTAAG CAGCAACTTA ACTTGATCTT CGTGTGACCG
ATCGATGGCT CGCGCGGCGA ATAATAAGTA TGTGGCGGCG GTGATGGTGG TGGCGCTGCT GTTGGCGGCG CCGGCGGCGA
GCGCGGTGAC ATGCGGGCAG GTGGTGAGCA TGCTGGCGCC GTGCATCATG TACGCGACGG GGAGGGTGTC CGCCCCCACC
GGCGGctgct gcgacggggt caggaccctc aactccgccg ccgccaccac cgccgaccgc cagaccacct gcgcctgcct
caagcagcag accagcgcca tgggcggcct gaggcccgac ctcgtcgccg gcaTCCCCTC CAAGTGCGGC GTCAACATCC
CCTACGCTAT CAGCCCTTCC ACCGACTGCT CCAGGTAATT CATTATAGTT GATTACCATC AGTATGATAT TTACTACGTA
CTACTACGAT TTTGATCTGT GCTATTAGCT GCAGCTTAAT TAACCATTAA TTGTTAATCT GCCTATGTAT TGTGCATTCG
CATGCAGGGT GCACTGAGTG GATCAACGTC AAGTGATGCC ACAATAATAA TGGAGAGATG GATCCATCGA TCTGCGGCTC
TCATTTTGCG GTTGCTATCT GCAATATTCG TCGTCGTCAG AGAGATCGAG CTAGAAATGC ATGTTACTCC TCCGTTCTGT
TACTATCTGC TTACCTGTTG CTTCGTCGCG GTTTGATAGT CGTCGTTATA GCTAGTGTAA GAGTGTGAGG GTTGATTTTG
ATCTGTCTCC TTTACGGGAC GAGGGGCAGA CGAATCATGC ATGAATCTTA GAGGACCTGC TTGCATTGTA CCTTACTGCA
TGCATGCATG CTTCAATATA TATCCATCAA ATGAAGAGTC TTTT