Os12t0114800-01

Locus

Os12g0114800

Description

Similar to Lipid transfer protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.16, OsLtpI.16

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.16, lipid transfer protein 1.16, type 1 non-specific lipid transfer protein 16

Transcript Evidence

AK104005 (DDBJ, Best hit)

AK060340 (DDBJ, Best hit)

AK072917 (DDBJ, Best hit)

AK119681 (DDBJ, Best hit)

Protein Evidence

Q2QYL3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

001-002-F05 (Online Clone Ordering)

001-008-D02 (Online Clone Ordering)

J023148L05 (Online Clone Ordering)

002-156-H12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0114800-01)

Others

Oryzabase (13525)

Transcript

668 bp

>Os12t0114800-01 Similar to Lipid transfer protein.
ACTCCAGTACTCCACCACAAGCTCTAGCTTACAGCTCACTACCAGTGTACATTGTTGCTA
GTTAGCTAGAGCTAGATCTCGATCGAGACAATGGCGGGTGCTCGCAGGACGATGGCGCTG
GTTGCGTTGGTGGCGGTGGTGGCGGCGGCGGTGGTGGCGGAGAGGGCGTCGGCGGCGGTG
AGCTGCGGCGACGTGACGTCGTCGATCGCGCCGTGCCTGTCGTACGTGATGGGGAGGGAG
AGCTCGCCGTCGTCGTCGTGCTGCAGCGGGGTGAGGACCCTCAACGGCAAGGCCTCCTCC
TCCGCCGACCGCCGCACCGCCTGCAGCTGCCTCAAGAACATGGCCTCCTCCTTCAGGAAC
CTCAACATGGGCAACGCCGCCTCCATCCCCAGCAAATGTGGCGTCTCCGTCGCCTTCCCC
ATCAGCACCTCCGTCGACTGCTCCAAGATCAACTAATTACTAGCTTGATCATCTCCAGCT
GAGATCGATATGTATGGGAAGATCTAGAGAGTGACTGTTCACTGCTAGCTTTGTTTATTT
TCTTGCTGCATGCGTACGTGCACTATATAATGTAATAATGCGTTTCAATGTTTACATGTA
GTGTACTATGTACACTACTTATATATTTTTCATATATATAATAATCTAATAATAATAATG
TTGTACTG

CDS

366 bp

>Os12t0114800-01 Similar to Lipid transfer protein.
ATGGCGGGTGCTCGCAGGACGATGGCGCTGGTTGCGTTGGTGGCGGTGGTGGCGGCGGCG
GTGGTGGCGGAGAGGGCGTCGGCGGCGGTGAGCTGCGGCGACGTGACGTCGTCGATCGCG
CCGTGCCTGTCGTACGTGATGGGGAGGGAGAGCTCGCCGTCGTCGTCGTGCTGCAGCGGG
GTGAGGACCCTCAACGGCAAGGCCTCCTCCTCCGCCGACCGCCGCACCGCCTGCAGCTGC
CTCAAGAACATGGCCTCCTCCTTCAGGAACCTCAACATGGGCAACGCCGCCTCCATCCCC
AGCAAATGTGGCGTCTCCGTCGCCTTCCCCATCAGCACCTCCGTCGACTGCTCCAAGATC
AACTAA

Protein

122 aa

>Os12t0114800-01 Similar to Lipid transfer protein.
MAGARRTMALVALVAVVAAAVVAERASAAVSCGDVTSSIAPCLSYVMGRESSPSSSCCSG
VRTLNGKASSSADRRTACSCLKNMASSFRNLNMGNAASIPSKCGVSVAFPISTSVDCSKI
N*

5'UTR

chr12:727802..727891 (+ strand) : 90 bp

CDS

chr12:727892..728247 (+ strand) : 356 bp

chr12:728338..728347 (+ strand) : 10 bp

3'UTR

chr12:728348..728559 (+ strand) : 212 bp

FASTA

>Os12t0114800-01 class=Sequence position=chr12:727802..728559 (+ strand)
ACTCCAGTAC TCCACCACAA GCTCTAGCTT ACAGCTCACT ACCAGTGTAC ATTGTTGCTA GTTAGCTAGA GCTAGATCTC
GATCGAGACA ATGGCGGGTG CTCGCAGGAC GATGGCGCTG GTTGCGTTGG TGGCGGTGGT GGCGGCGGCG GTGGTGGCGG
AGAGGGCGTC GGCGGCGGTG AGCTGCGGCG ACGTGACGTC GTCGATCGCG CCGTGCCTGT CGTACGTGAT GGGGAGGGAG
AGCTCGCCGT CGTCGTCGTG CTGCAGCGGG GTGAGGACCC TCAACGGCAA GGCCTCCTCC TCCGCCGACC GCCGCACCGC
CTGCAGCTGC CTCAAGAACA TGGCCTCCTC CTTCAGGAAC CTCAACATGG GCAACGCCGC CTCCATCCCC AGCAAATGTG
GCGTCTCCGT CGCCTTCCCC ATCAGCACCT CCGTCGACTG CTCCAAGTAT TCTACATTTT CTCTCTCTCT ATCTGCATTT
GCTCCATCCA TGTGTTGGCC TAATTAAGCT AATTTCCTCT TTCCTTTTTT ATGCAGGATC AACTAATTAC TAGCTTGATC
ATCTCCAGCT GAGATCGATA TGTATGGGAA GATCTAGAGA GTGACTGTTC ACTGCTAGCT TTGTTTATTT TCTTGCTGCA
TGCGTACGTG CACTATATAA TGTAATAATG CGTTTCAATG TTTACATGTA GTGTACTATG TACACTACTT ATATATTTTT
CATATATATA ATAATCTAAT AATAATAATG TTGTACTG

Locus: Os12g0114800

Loading...

Locus: Os12g0114800

Loading...