Os12t0115100-00

Locus

Os12g0115100

Description

Nonspecific lipid-transfer protein 1 precursor (LTP 1) (PAPI).

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.18, OsLTP1, nsLTP1, a15, OsLtpI.18

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.18, lipid transfer protein 1.18, type 1 non-specific lipid transfer protein 18, nonspecific lipid transfer protein-1, lipid transfer protein a15

Transcript Evidence

CU406598 (DDBJ, Best hit)

Protein Evidence

Q2RBD2 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Expression Databases

TENOR (Os12t0115100-00)

Others

Oryzabase (13527)

KEGG (Os12t0115100-00)

Transcript

803 bp

>Os12t0115100-00 Nonspecific lipid-transfer protein 1 precursor (LTP 1) (PAPI).
ATCCATCCATCATCCATCTCATCATCAGCAACCAATTCGCACCGATCGATCGATCGATCC
AGCAACTAGATCAACAGTACTAGCTAGGAAGCATGGCCCGTGCACAGTTGGTGTTGGTCG
CCCTGGTGGCAGCTCTGCTCCTCGCCGCCCCGCACGCCGCCGTGGCCATCACCTGCGGCC
AGGTCAACTCCGCCGTCGGGCCCTGCCTGACCTACGCCCGCGGCGGCGCCGGGCCGTCGG
CGGCCTGCTGCAGCGGCGTGAGGAGCCTCAAGGCGGCAGCAAGCACGACCGCAGACCGGC
GCACCGCCTGCAACTGCCTCAAGAACGCGGCCCGCGGCATCAAGGGGCTCAACGCCGGCA
ACGCCGCCAGCATCCCCTCCAAGTGCGGCGTCAGCGTCCCCTACACCATCAGCGCTTCCA
TCGACTGCTCCAGGGTGAGCTGAGCCATCGATCAGAGACGGATCATATATATACAGCAGC
GCGCCGGTTGCCACCTAGTAGATTCTGCCTGGGTCGATGTGTGGAGCCGAATTCTGTATC
CAGTACTAGTAGTATCATATCTGTATTCTGGAATAAAAGATGAGCTAGCTAAGGTCTCGA
TCAATCACCATGCATCCATGGTTGATCGGCCCGGTCACGCTAGCTAGCTTTCTTCTTCTT
GTGTGTTCGTCTCGTACGTTTTGCTCCTTTTCGAGGGGTACGTGTACCAGAGAGAGCTAG
AGATTCTACATGCATGTACTGCAACTCCTTGTACTACGTGCTTGTTTTGGATTATTACAC
ATACATATAGCTCTTTTTCGTAC

CDS

351 bp

>Os12t0115100-00 Nonspecific lipid-transfer protein 1 precursor (LTP 1) (PAPI).
ATGGCCCGTGCACAGTTGGTGTTGGTCGCCCTGGTGGCAGCTCTGCTCCTCGCCGCCCCG
CACGCCGCCGTGGCCATCACCTGCGGCCAGGTCAACTCCGCCGTCGGGCCCTGCCTGACC
TACGCCCGCGGCGGCGCCGGGCCGTCGGCGGCCTGCTGCAGCGGCGTGAGGAGCCTCAAG
GCGGCAGCAAGCACGACCGCAGACCGGCGCACCGCCTGCAACTGCCTCAAGAACGCGGCC
CGCGGCATCAAGGGGCTCAACGCCGGCAACGCCGCCAGCATCCCCTCCAAGTGCGGCGTC
AGCGTCCCCTACACCATCAGCGCTTCCATCGACTGCTCCAGGGTGAGCTGA

Protein

117 aa

>Os12t0115100-00 Nonspecific lipid-transfer protein 1 precursor (LTP 1) (PAPI).
MARAQLVLVALVAALLLAAPHAAVAITCGQVNSAVGPCLTYARGGAGPSAACCSGVRSLK
AAASTTADRRTACNCLKNAARGIKGLNAGNAASIPSKCGVSVPYTISASIDCSRVS*

5'UTR

chr12:737314..737405 (+ strand) : 92 bp

CDS

chr12:737406..737746 (+ strand) : 341 bp

chr12:737885..737894 (+ strand) : 10 bp

3'UTR

chr12:737895..738254 (+ strand) : 360 bp

FASTA

>Os12t0115100-00 class=Sequence position=chr12:737314..738254 (+ strand)
ATCCATCCAT CATCCATCTC ATCATCAGCA ACCAATTCGC ACCGATCGAT CGATCGATCC AGCAACTAGA TCAACAGTAC
TAGCTAGGAA GCATGGCCCG TGCACAGTTG GTGTTGGTCG CCCTGGTGGC AGCTCTGCTC CTCGCCGCCC CGCACGCCGC
CGTGGCCATC ACCTGCGGCC AGGTCAACTC CGCCGTCGGG CCCTGCCTGA CCTACGCCCG CGGCGGCGCC GGGCCGTCGG
CGGCCTGCTG CAGCGGCGTG AGGAGCCTCA AGGCGGCAGC AAGCACGACC GCAGACCGGC GCACCGCCTG CAACTGCCTC
AAGAACGCGG CCCGCGGCAT CAAGGGGCTC AACGCCGGCA ACGCCGCCAG CATCCCCTCC AAGTGCGGCG TCAGCGTCCC
CTACACCATC AGCGCTTCCA TCGACTGCTC CAGGTAATTA GTTAATCATC TCATCATCTC TCTCTCTATA TATACATCTA
ATTCCGTTAA ATATATATAA TTACGCATGG CTTTGCATGA TGGAGTACTA TATACATGTC ATCTAATCTA TATATATGTG
CGTGTGTGCA GGGTGAGCTG AGCCATCGAT CAGAGACGGA TCATATATAT ACAGCAGCGC GCCGGTTGCC ACCTAGTAGA
TTCTGCCTGG GTCGATGTGT GGAGCCGAAT TCTGTATCCA GTACTAGTAG TATCATATCT GTATTCTGGA ATAAAAGATG
AGCTAGCTAA GGTCTCGATC AATCACCATG CATCCATGGT TGATCGGCCC GGTCACGCTA GCTAGCTTTC TTCTTCTTGT
GTGTTCGTCT CGTACGTTTT GCTCCTTTTC GAGGGGTACG TGTACCAGAG AGAGCTAGAG ATTCTACATG CATGTACTGC
AACTCCTTGT ACTACGTGCT TGTTTTGGAT TATTACACAT ACATATAGCT CTTTTTCGTA C

Locus: Os12g0115100

Loading...

Locus: Os12g0115100

Loading...