Os12t0115500-01

Locus

Os12g0115500

Description

Similar to nonspecific lipid-transfer protein 3.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsLTP1.20, OsLtpI.20, LTP1.20, OsLTPL14, LTPL14

Oryzabase Gene Name Synonym(s)

non-specific lipid transfer protein 1.20, lipid transfer protein 1.20, type 1 non-specific lipid transfer protein 20

Transcript Evidence

AK241677 (DDBJ, Best hit)

Protein Evidence

Q2QYK8 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: lipid transport (GO:0006869)

Molecular Function: lipid binding (GO:0008289)

Functional domain (InterPro)

Plant lipid transfer protein/Par allergen (IPR000528)

Plant lipid transfer protein/seed storage/trypsin-alpha amylase inhibitor (IPR003612)

Plant lipid transfer protein/hydrophobic protein, helical domain (IPR013770)

Bifunctional inhibitor/plant lipid transfer protein/seed storage (IPR016140)

Full-length cDNA

J065193A09 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0115500-01)

Others

Oryzabase (13529)

KEGG (Os12t0115500-01)

Transcript

722 bp

>Os12t0115500-01 Similar to nonspecific lipid-transfer protein 3.
CATCACCGGCGGCGACGATTAGCTATCTAGCTTAGCTACTCGATCATCAGATCATCGATC
ATCCGACGATCAAATCAGTAATCTTGAATATGGCGGCTTTGAACGGTAAGGTGGTGGTGG
CGGTGATGGTGGTGGCGATGGTGGTGGCGGCGCCGGGAGCGTCGGCGGCGATCACGTGCG
GTCAGGTGGGATCGGCGATCGCGCCGTGCATCTCGTACGTGACGGGGAGGAGCGGGCTGA
CGCAGGGATGCTGCAACGGCGTCAAGGGGCTGAACAACGCCGCCCGCACCACCGCCGACC
GCCAGGCGGCCTGCCGCTGCCTCAAGAGCCTCGCCGGCAGCATCAAGTCGCTCAACCTCG
GCACCGTCGCCGGCGTCCCCGGCAAATGCGGCGTCAACGTTGGCTTCCCCATCAGCCTCT
CCACCGACTGCAACAAGGTCAGTTAAATCAATCCTGCTTGGATCGATCGATCGAGCTTAA
CATGCTAGCTCAATCGGAGTTGATCAGCTAGTAATTAAGCACGTACTTGCTACAGCATAT
ATGAACAAAGTAATTAAAATAACAGCTGCGGCAGACATGCAGCGCTCCATTCTCTCTCTG
TATCAGCTGTATACTTTATGTTGCACGCTCCCTGTGTGCATGTTCTATCTTAATTTTCTT
CAGTATGTACACGATCTGTGCGTACGTGTAATCCTATACGTTTTATGAATTGCATGTTGT
CC

CDS

357 bp

>Os12t0115500-01 Similar to nonspecific lipid-transfer protein 3.
ATGGCGGCTTTGAACGGTAAGGTGGTGGTGGCGGTGATGGTGGTGGCGATGGTGGTGGCG
GCGCCGGGAGCGTCGGCGGCGATCACGTGCGGTCAGGTGGGATCGGCGATCGCGCCGTGC
ATCTCGTACGTGACGGGGAGGAGCGGGCTGACGCAGGGATGCTGCAACGGCGTCAAGGGG
CTGAACAACGCCGCCCGCACCACCGCCGACCGCCAGGCGGCCTGCCGCTGCCTCAAGAGC
CTCGCCGGCAGCATCAAGTCGCTCAACCTCGGCACCGTCGCCGGCGTCCCCGGCAAATGC
GGCGTCAACGTTGGCTTCCCCATCAGCCTCTCCACCGACTGCAACAAGGTCAGTTAA

Protein

119 aa

>Os12t0115500-01 Similar to nonspecific lipid-transfer protein 3.
MAALNGKVVVAVMVVAMVVAAPGASAAITCGQVGSAIAPCISYVTGRSGLTQGCCNGVKG
LNNAARTTADRQAACRCLKSLAGSIKSLNLGTVAGVPGKCGVNVGFPISLSTDCNKVS*

5'UTR

chr12:760947..761035 (+ strand) : 89 bp

CDS

chr12:761036..761382 (+ strand) : 347 bp

chr12:762096..762105 (+ strand) : 10 bp

3'UTR

chr12:762106..762381 (+ strand) : 276 bp

FASTA

>Os12t0115500-01 class=Sequence position=chr12:760947..762381 (+ strand)
CATCACCGGC GGCGACGATT AGCTATCTAG CTTAGCTACT CGATCATCAG ATCATCGATC ATCCGACGAT CAAATCAGTA
ATCTTGAATA TGGCGGCTTT GAACGGTAAG GTGGTGGTGG CGGTGATGGT GGTGGCGATG GTGGTGGCGG CGCCGGGAGC
GTCGGCGGCG ATCACGTGCG GTCAGGTGGG ATCGGCGATC GCGCCGTGCA TCTCGTACGT GACGGGGAGG AGCGGGCTGA
CGCAGGGATG CTGCAACGGC GTCAAGGGGC TGAACAACGC CGCCCGCACC ACCGCCGACC GCCAGGCGGC CTGCCGCTGC
CTCAAGAGCC TCGCCGGCAG CATCAAGTCG CTCAACCTCG GCACCGTCGC CGGCGTCCCC GGCAAATGCG GCGTCAACGT
TGGCTTCCCC ATCAGCCTCT CCACCGACTG CAACAAGTAT ATCATCTCTC TTTATTATGA CGTCCCCCCC CTCTCTCTCT
ATATATATAC ACACATATAT CTCTTTATTT TTTAGTGCTA TCTAAATACT CCTCCGTTTC AGGTTATATG ACGTTTTAAC
TTTggttaaa gtcaaactac tctaagttga actaattcta tagaaaagta ataatattta caataccagc atagtttcat
taaatctata attgaataat ttttcataat atacttgtct tgggttaaaa atgttactac tttttttcta caaaatcagt
caaacttata atagttcgac tttgaCTAAA GTCAAAACGT CTTATAACCT GAAACGGAGT aatagttaat aaaaactttt
acaagttaaa atagattatc atatgtgaga tatatctcac ttcatagaca taaaagatta aattcaactt atacaagtta
attagaaaaa caacaaacta aactaacact acttaacgta ttttcgctat tatatccgtt atttttgttg caagtacaag
ttaaatttaa acatgtatat ttacggacat gtatattaat attaatctag cttatcattt tgttttactt tttaatggct
atttaggtgg ggggcatgaa agcaacaatg agatatttct cgagatatga aacattttcc cATAAAATAA CTAACTTTCT
ATATATGTGC ATTTTTTTCT TTGGTGCAGG GTCAGTTAAA TCAATCCTGC TTGGATCGAT CGATCGAGCT TAACATGCTA
GCTCAATCGG AGTTGATCAG CTAGTAATTA AGCACGTACT TGCTACAGCA TATATGAACA AAGTAATTAA AATAACAGCT
GCGGCAGACA TGCAGCGCTC CATTCTCTCT CTGTATCAGC TGTATACTTT ATGTTGCACG CTCCCTGTGT GCATGTTCTA
TCTTAATTTT CTTCAGTATG TACACGATCT GTGCGTACGT GTAATCCTAT ACGTTTTATG AATTGCATGT TGTCC

Locus: Os12g0115500

Loading...

Locus: Os12g0115500

Loading...