Os12t0116800-01

Locus

Os12g0116800

Description

WRKY transcription factor, Bacterial blight disease resistance, Bakanae disease resistance

RAP-DB Gene Symbol Synonym(s)

OsWRKY65

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

WRKY65

CGSNL Gene Name

WRKY GENE65

Oryzabase Gene Symbol Synonym(s)

OsWRKY65

Oryzabase Gene Name Synonym(s)

Rice WRKY gene65

Transcript Evidence

Inferred from literature

Protein Evidence

Q6IEL6 (indica)

Literature

PMID: 33097183

Rice WRKY Working Group 2012. Rice 5:3.

Note

Manual Curation

October 27, 2020

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA-binding transcription factor activity (GO:0003700)

Molecular Function: sequence-specific DNA binding (GO:0043565)

Functional domain (InterPro)

WRKY domain superfamily (IPR036576)

WRKY domain (IPR003657)

Experimentally confirmed subcellular location

nucleus (GO:0005634)

Expression Databases

TENOR (Os12t0116800-00)

TENOR (Os12t0116750-00)

Others

Oryzabase (6580)

Transcript

1026 bp

>Os12t0116800-01 WRKY transcription factor, Bacterial blight disease resistance, Bakanae disease resistance
ATGGAGGAGGCCTACTGCATGATGATGGTGGGGAGGGAGAGGGAGCTCGTGGCTGAGCTG
CGTCACCTCCTCTTCCCTTCTCCGTCTCCGACCACCCCCGCGAGCCACTCTACTACTGCG
CTCACCGGCGACGACGAGTGCTTGCCGCCAGGGCTGACAACGACGACGACGGTGTCCGGT
GGTGGAGGACGGCGGCGGGGGAGGAAGAGAGTCCGCCGCGACAATGATAATCTCAAGCTG
CTTCAGGCAGATGATGATCAGGAGGTCCTAGCAGCAGCTGTTCATGGCGATGCAAATGCC
AAGCCTCTTCCTAATTTCACCAAAACAAGCAGGAGGAAGCTGCAGACGACAACATCAACG
ATGGTAACGACGGTGCCAGATTTCGATGGGTATCAATGGAGGAAGTATGGTCAGAAGCAA
ATTGAAGGTGCCATGTACCCCAGgagctactaccggtgcaccaacagcacaaaccagggc
tgcctcgccaaaaagacggtgcagcgcaatggcggcggcggagcagcagggtacacggtg
gcctacatctcagagcatacttgcaagtccaTCGAACCATCGCTGCCTCCGGTCATCCTC
GACACCACCGTCCGTGCTACCAACAACCACCACCCGCCTGCAGCCTCTTCTTCTTGTGCT
GCTCAATCACCGGCGGCGGCGGCGACATCGTCGTCGTCGGATATGATGATGACGAGTACT
AGCAGTACTAGTAGCGAGACTGGTAATTGGAGCGGTCAGCACGGCGCCTACGCGTGCCGT
CGACAGATGATCGCCGCCGATGAAGAGTACTGCTGCTGGGACACTCCGGCGACGACGACC
ACCTCTGGTTCTGATGGTGGTAACAGTAGTACTTGTGCCGATCAGGTGATAGACTTGATG
AGCGGGCCCATCAGGTCGCCGCTGCACATCGCGGCGGACGGGAATTGGGTGGACGATTTG
CTTCTTGTTGGTGATGGGCTTATCGACATATCCAGCGCTAACATCACCCATTTGTTCAGT
TTCTAG

CDS

1026 bp

>Os12t0116800-01 WRKY transcription factor, Bacterial blight disease resistance, Bakanae disease resistance
ATGGAGGAGGCCTACTGCATGATGATGGTGGGGAGGGAGAGGGAGCTCGTGGCTGAGCTG
CGTCACCTCCTCTTCCCTTCTCCGTCTCCGACCACCCCCGCGAGCCACTCTACTACTGCG
CTCACCGGCGACGACGAGTGCTTGCCGCCAGGGCTGACAACGACGACGACGGTGTCCGGT
GGTGGAGGACGGCGGCGGGGGAGGAAGAGAGTCCGCCGCGACAATGATAATCTCAAGCTG
CTTCAGGCAGATGATGATCAGGAGGTCCTAGCAGCAGCTGTTCATGGCGATGCAAATGCC
AAGCCTCTTCCTAATTTCACCAAAACAAGCAGGAGGAAGCTGCAGACGACAACATCAACG
ATGGTAACGACGGTGCCAGATTTCGATGGGTATCAATGGAGGAAGTATGGTCAGAAGCAA
ATTGAAGGTGCCATGTACCCCAGgagctactaccggtgcaccaacagcacaaaccagggc
tgcctcgccaaaaagacggtgcagcgcaatggcggcggcggagcagcagggtacacggtg
gcctacatctcagagcatacttgcaagtccaTCGAACCATCGCTGCCTCCGGTCATCCTC
GACACCACCGTCCGTGCTACCAACAACCACCACCCGCCTGCAGCCTCTTCTTCTTGTGCT
GCTCAATCACCGGCGGCGGCGGCGACATCGTCGTCGTCGGATATGATGATGACGAGTACT
AGCAGTACTAGTAGCGAGACTGGTAATTGGAGCGGTCAGCACGGCGCCTACGCGTGCCGT
CGACAGATGATCGCCGCCGATGAAGAGTACTGCTGCTGGGACACTCCGGCGACGACGACC
ACCTCTGGTTCTGATGGTGGTAACAGTAGTACTTGTGCCGATCAGGTGATAGACTTGATG
AGCGGGCCCATCAGGTCGCCGCTGCACATCGCGGCGGACGGGAATTGGGTGGACGATTTG
CTTCTTGTTGGTGATGGGCTTATCGACATATCCAGCGCTAACATCACCCATTTGTTCAGT
TTCTAG

Protein

342 aa

>Os12t0116800-01 WRKY transcription factor, Bacterial blight disease resistance, Bakanae disease resistance
MEEAYCMMMVGRERELVAELRHLLFPSPSPTTPASHSTTALTGDDECLPPGLTTTTTVSG
GGGRRRGRKRVRRDNDNLKLLQADDDQEVLAAAVHGDANAKPLPNFTKTSRRKLQTTTST
MVTTVPDFDGYQWRKYGQKQIEGAMYPRSYYRCTNSTNQGCLAKKTVQRNGGGGAAGYTV
AYISEHTCKSIEPSLPPVILDTTVRATNNHHPPAASSSCAAQSPAAAATSSSSDMMMTST
SSTSSETGNWSGQHGAYACRRQMIAADEEYCCWDTPATTTTSGSDGGNSSTCADQVIDLM
SGPIRSPLHIAADGNWVDDLLLVGDGLIDISSANITHLFSF*

CDS

chr12:838427..838755 (- strand) : 329 bp

chr12:838117..838230 (- strand) : 114 bp

chr12:836516..837098 (- strand) : 583 bp

FASTA

>Os12t0116800-01 class=Sequence position=chr12:836516..838755 (- strand)
ATGGAGGAGG CCTACTGCAT GATGATGGTG GGGAGGGAGA GGGAGCTCGT GGCTGAGCTG CGTCACCTCC TCTTCCCTTC
TCCGTCTCCG ACCACCCCCG CGAGCCACTC TACTACTGCG CTCACCGGCG ACGACGAGTG CTTGCCGCCA GGGCTGACAA
CGACGACGAC GGTGTCCGGT GGTGGAGGAC GGCGGCGGGG GAGGAAGAGA GTCCGCCGCG ACAATGATAA TCTCAAGCTG
CTTCAGGCAG ATGATGATCA GGAGGTCCTA GCAGCAGCTG TTCATGGCGA TGCAAATGCC AAGCCTCTTC CTAATTTCAC
CAAAACAAGG TGCTAATTAA TATATCCATG CATCAAGCTT AATTAATTTC TAGGTGTCCA TCAATAACAA GAACACTGCA
CACCGCACCT GCTTTCTTTT TTGTTATATT TCTGAAAGCA AATATAATCA ATATAATGCA CGAACGGTTC GGTTCATCAT
GGATTTAGAA ATTTTGATTA CATCTAGCTA GTTATGTATA TGCAGCAGGA GGAAGCTGCA GACGACAACA TCAACGATGG
TAACGACGGT GCCAGATTTC GATGGGTATC AATGGAGGAA GTATGGTCAG AAGCAAATTG AAGGTGCCAT GTACCCCAGG
TACCATATCA TTCCATATTT ACATATGTAT GTATTGTCAC TACTGCTACA TCAGTGTCAT AAATCGCCAC TGTTTAGCAC
TGTTGCTACA GTACTGCTAC GTCAGAACAC TGTAGCACAA GACAGATTAC TGTGCGCCTC TACTTAGAAC GAGCTAAGTC
AGAGCAGCCG GTTCCGACTT GCAAGCATGC TCTGAGATGG AATCATTAAT GTTATAAAAT CAAGAAACTG CAGCCTTGAA
ACTCTCCCTA TGCAAGAAAT TAATGAGACC ATCTATCTCA AAATAggctt gtttagttcc cccataaact tttcctaaaa
acatcatatc aaatctttgg acacatatat tgagtattaa atatagataa aaagaaaaac taattgcatt gtttgcatgt
aaaacgcgag acgaatcttt tgagcctaat taggctatga ttagccataa gtgctacagt aacccacatg tgctaatgac
ggattaatta agctcaaaag attcgtctcg cggtttccag gcgagttata aaattagttt tttcattcat gtccccgaaa
acccgttccg acatctggtc aaacgttcga tgtgacacct tattttatca actaaacaAG CCTCACGAGA GATCAGAAAT
TAAGCCTTTT TGGTTATGAC GTGGCATGCG CAGACAATCG ATCAGTCCTT TCACTCGGAT ACGCGTAACA TATGCATGCA
ACCTTTGTGA ATTGGTCGTA CAGTACGTAC GTGTAGGGCC CACAAGCCCA TTACTAGGTG AATGATTAAT TGCACGCATC
GTCGCGCGAT ACACATTGTT GGGGTATGTT ACAACAGATC CTACATATGT GTGATTGATT CCACTAGAAT TAATTATCCA
CATATAAAAG CTGAAAAACT GAAGTGAAAA ATGCAAGATC ATATAGTAAT TAGCTACTAG GTTGCAAGTT TGTAATGATA
TATGGATGTG TGACTAATTA ATTACTGTAA TTAACATAGA TCGATGGACG CATGcaggag ctactaccgg tgcaccaaca
gcacaaacca gggctgcctc gccaaaaaga cggtgcagcg caatggcggc ggcggagcag cagggtacac ggtggcctac
atctcagagc atacttgcaa gtccaTCGAA CCATCGCTGC CTCCGGTCAT CCTCGACACC ACCGTCCGTG CTACCAACAA
CCACCACCCG CCTGCAGCCT CTTCTTCTTG TGCTGCTCAA TCACCGGCGG CGGCGGCGAC ATCGTCGTCG TCGGATATGA
TGATGACGAG TACTAGCAGT ACTAGTAGCG AGACTGGTAA TTGGAGCGGT CAGCACGGCG CCTACGCGTG CCGTCGACAG
ATGATCGCCG CCGATGAAGA GTACTGCTGC TGGGACACTC CGGCGACGAC GACCACCTCT GGTTCTGATG GTGGTAACAG
TAGTACTTGT GCCGATCAGG TGATAGACTT GATGAGCGGG CCCATCAGGT CGCCGCTGCA CATCGCGGCG GACGGGAATT
GGGTGGACGA TTTGCTTCTT GTTGGTGATG GGCTTATCGA CATATCCAGC GCTAACATCA CCCATTTGTT CAGTTTCTAG

Locus: Os12g0116800

Loading...

Locus: Os12g0116800

Loading...