Os12t0118900-01

Locus

Os12g0118900

Description

Cytochrome P450 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP714C1

CGSNL Gene Name

P-450 714C1

Oryzabase Gene Symbol Synonym(s)

CYP714C1

Oryzabase Gene Name Synonym(s)

Cytochrome P450 714C1

Transcript Evidence

AK062692 (DDBJ, Best hit)

Protein Evidence

B9GBJ9 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

001-106-A04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0118900-01)

RiceXPro (AK062692)

Others

Oryzabase (12265)

KEGG (Os12t0118900-01)

Transcript

1182 bp

>Os12t0118900-01 Cytochrome P450 family protein.
TGTCGATGATTACTTGCGGAACTTGTCAGCAGATGTAATTGCCAGGGCTTGCTTTGGGAG
TAGCTTCACAAAAGGAGAAGAAATATTTTGCAAGCTTAGGCAGCTCCAAAAAGTAATTGC
TCAGCAAGATTCGTTTGTTGGTCTGTCTGCACTGTGGAAATACCTGCCAACCAAGAGCAA
CCAAGAAATACAGATGCTGGATGAACAAGTCCGCTTACTGATCCTGGATGTCGCAAAGGA
ACAACACCACTACCAAGACTCACACAACAGTCTTGTCAACGCCATCATTGATGGTGCGCA
GGATGGTCGCAGCGCTGCAGAGGCTGAGGACTTTATCGTCGGAAACTGTAAGACCATCTA
CTTCGGAGGTCACGAGAGCACGGCGGTCACCGCCATCTGGTGCCTGATGCTACTCGCCAC
GCACTCTGAGGCAATGGAGGTTTGCCGGGGAAGGTCGACATTGGACGTGGACGCCCTTCG
CCGGTTAAAGATTGTGACGATGGTGATCCAGGAGACGCTTCGGCTGTACCCGCCGGCGTC
GGTGATGATGCAGGAGGCCCTGACGGACGTGAAGCTTGGCAACATCGAGGTGCCTCGCGG
CACCATCGTGCAGGTGCCCAGGCTGATGCTGCACCTGGACAAGGAAGCCTGGGGCGCCGA
CGCCGACGAGTTCCGGCCGGACCGGTTCGCGAACGGCGTGGCGGCGGCGTGCAGGGCGGC
GCACATGTACGTGCCGTTCGGGCACGGGCCCAGGACGTGCATCGGGCAGAACCTGGCAAT
GGCGGAGCTGAAGGTGGTGTTGGCCAGGCTGCTGACAAAGTTCGCCTTCTCGCCGTCGCC
GAGGTACCGTCACTCGCCGGCGTTCAGGCTGACCATTGAACCCGGGTTCGGCTTGCCACT
CATGGTGACAAAGCTGCCATGAGCTAGCAGCCCTGTTACTCACACCCACCCAGTCGATTC
ATGACAGCTCCAGTTATAATTGCTGGCCACAGACAGCAATGCTTGTTATAATAAAGCTCC
TTTTTTGAGATGAAGTTGTTAAGCACTCTAAGCTCGTTGAACCCAATCAAAGGGTTTTAT
GATGGAGAACATTGTTGCGATCCATTCTTTTGGGTTGAAAAAGTAAGAGAGGCCATCACT
CCCTTTTGTATGAAAAAAAAAAAGGCATTTGTCTGGTTTGCC

CDS

921 bp

>Os12t0118900-01 Cytochrome P450 family protein.
GTCGATGATTACTTGCGGAACTTGTCAGCAGATGTAATTGCCAGGGCTTGCTTTGGGAGT
AGCTTCACAAAAGGAGAAGAAATATTTTGCAAGCTTAGGCAGCTCCAAAAAGTAATTGCT
CAGCAAGATTCGTTTGTTGGTCTGTCTGCACTGTGGAAATACCTGCCAACCAAGAGCAAC
CAAGAAATACAGATGCTGGATGAACAAGTCCGCTTACTGATCCTGGATGTCGCAAAGGAA
CAACACCACTACCAAGACTCACACAACAGTCTTGTCAACGCCATCATTGATGGTGCGCAG
GATGGTCGCAGCGCTGCAGAGGCTGAGGACTTTATCGTCGGAAACTGTAAGACCATCTAC
TTCGGAGGTCACGAGAGCACGGCGGTCACCGCCATCTGGTGCCTGATGCTACTCGCCACG
CACTCTGAGGCAATGGAGGTTTGCCGGGGAAGGTCGACATTGGACGTGGACGCCCTTCGC
CGGTTAAAGATTGTGACGATGGTGATCCAGGAGACGCTTCGGCTGTACCCGCCGGCGTCG
GTGATGATGCAGGAGGCCCTGACGGACGTGAAGCTTGGCAACATCGAGGTGCCTCGCGGC
ACCATCGTGCAGGTGCCCAGGCTGATGCTGCACCTGGACAAGGAAGCCTGGGGCGCCGAC
GCCGACGAGTTCCGGCCGGACCGGTTCGCGAACGGCGTGGCGGCGGCGTGCAGGGCGGCG
CACATGTACGTGCCGTTCGGGCACGGGCCCAGGACGTGCATCGGGCAGAACCTGGCAATG
GCGGAGCTGAAGGTGGTGTTGGCCAGGCTGCTGACAAAGTTCGCCTTCTCGCCGTCGCCG
AGGTACCGTCACTCGCCGGCGTTCAGGCTGACCATTGAACCCGGGTTCGGCTTGCCACTC
ATGGTGACAAAGCTGCCATGA

Protein

307 aa

>Os12t0118900-01 Cytochrome P450 family protein.
VDDYLRNLSADVIARACFGSSFTKGEEIFCKLRQLQKVIAQQDSFVGLSALWKYLPTKSN
QEIQMLDEQVRLLILDVAKEQHHYQDSHNSLVNAIIDGAQDGRSAAEAEDFIVGNCKTIY
FGGHESTAVTAIWCLMLLATHSEAMEVCRGRSTLDVDALRRLKIVTMVIQETLRLYPPAS
VMMQEALTDVKLGNIEVPRGTIVQVPRLMLHLDKEAWGADADEFRPDRFANGVAAACRAA
HMYVPFGHGPRTCIGQNLAMAELKVVLARLLTKFAFSPSPRYRHSPAFRLTIEPGFGLPL
MVTKLP*

5'UTR

chr12:910825..910825 (+ strand) : 1 bp

CDS

chr12:910826..910980 (+ strand) : 155 bp

chr12:911275..911611 (+ strand) : 337 bp

chr12:911707..912135 (+ strand) : 429 bp

3'UTR

chr12:912136..912395 (+ strand) : 260 bp

FASTA

>Os12t0118900-01 class=Sequence position=chr12:910825..912395 (+ strand)
TGTCGATGAT TACTTGCGGA ACTTGTCAGC AGATGTAATT GCCAGGGCTT GCTTTGGGAG TAGCTTCACA AAAGGAGAAG
AAATATTTTG CAAGCTTAGG CAGCTCCAAA AAGTAATTGC TCAGCAAGAT TCGTTTGTTG GTCTGTCTGC ACTGTGGTAA
GTCAATGAAA TTAGTTGCAA TGAAATGAGA ACCTTCACGT GTGTATCATG ATATTAACCA AGAAATAGTC TTTTGTATAC
TCCTTATTAA TTTGAGATTA GTAGGTAACA AGTCCTGTCA TTCAGTAGAG ACAAATAGGT AGAAAACCTC GCCGTAAACT
GTTTTCAAAC AGCACATGCT TAAAGTATTA TAATTCAAGC ATGGCATAAA CTAGACTTAC ATGTCACAAT CACAGCTATA
AGTGATCAGG TATGCTAATT TAGATGGTTC ATGCTATATT GCTGTTGTAG GAAATACCTG CCAACCAAGA GCAACCAAGA
AATACAGATG CTGGATGAAC AAGTCCGCTT ACTGATCCTG GATGTCGCAA AGGAACAACA CCACTACCAA GACTCACACA
ACAGTCTTGT CAACGCCATC ATTGATGGTG CGCAGGATGG TCGCAGCGCT GCAGAGGCTG AGGACTTTAT CGTCGGAAAC
TGTAAGACCA TCTACTTCGG AGGTCACGAG AGCACGGCGG TCACCGCCAT CTGGTGCCTG ATGCTACTCG CCACGCACTC
TGAGGCAATG GAGGTTTGCC GGGGAAGGTC GACATTGGAC GTGGACGCCC TTCGCCGGTT AAAGATTGTG AGAAATTAAC
ATCTTAAACC GCATTGTTCA TCGTAGAAAT TAACAATGGC TGTTTACTGA TGATGAATGA CAACGATGTC GAAATGATGC
AGGTGACGAT GGTGATCCAG GAGACGCTTC GGCTGTACCC GCCGGCGTCG GTGATGATGC AGGAGGCCCT GACGGACGTG
AAGCTTGGCA ACATCGAGGT GCCTCGCGGC ACCATCGTGC AGGTGCCCAG GCTGATGCTG CACCTGGACA AGGAAGCCTG
GGGCGCCGAC GCCGACGAGT TCCGGCCGGA CCGGTTCGCG AACGGCGTGG CGGCGGCGTG CAGGGCGGCG CACATGTACG
TGCCGTTCGG GCACGGGCCC AGGACGTGCA TCGGGCAGAA CCTGGCAATG GCGGAGCTGA AGGTGGTGTT GGCCAGGCTG
CTGACAAAGT TCGCCTTCTC GCCGTCGCCG AGGTACCGTC ACTCGCCGGC GTTCAGGCTG ACCATTGAAC CCGGGTTCGG
CTTGCCACTC ATGGTGACAA AGCTGCCATG AGCTAGCAGC CCTGTTACTC ACACCCACCC AGTCGATTCA TGACAGCTCC
AGTTATAATT GCTGGCCACA GACAGCAATG CTTGTTATAA TAAAGCTCCT TTTTTGAGAT GAAGTTGTTA AGCACTCTAA
GCTCGTTGAA CCCAATCAAA GGGTTTTATG ATGGAGAACA TTGTTGCGAT CCATTCTTTT GGGTTGAAAA AGTAAGAGAG
GCCATCACTC CCTTTTGTAT GAAAAAAAAA AAGGCATTTG TCTGGTTTGC C

Locus: Os12g0118900

Loading...

Locus: Os12g0118900

Loading...