Os12t0119000-01

Locus

Os12g0119000

Description

Cytochrome P450 family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CYP714C2

CGSNL Gene Name

P-450 714C2

Oryzabase Gene Symbol Synonym(s)

CYP714C2

Oryzabase Gene Name Synonym(s)

Cytochrome P450 714C2

Transcript Evidence

AK066943 (DDBJ, Best hit)

Protein Evidence

XP_002319441.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: electron carrier activity (GO:0009055)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

J013089N23 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0119000-01)

RiceXPro (AK066943)

Others

Oryzabase (12266)

KEGG (Os12t0119000-01)

Transcript

2097 bp

>Os12t0119000-01 Cytochrome P450 family protein.
GATTCTTCTTAATCAGTCAGTTTCCTCATCCTCTTTGCATCCTCCGCGCCCTCGCGCTGA
TACTTGTAATCAATCAACTCATCAGCATGGTCTTCGCATGGAGCTGCTAGCTGCAGAGTC
ACAGAGCCCAATTGTTGAGCTCGAAATGCCACGTGTTGTATGATCGTTACATGCTAACTG
CTCAGAGTGAGTGAGGCGCTTCTTTGCGGCTTTATGTCCTTTTCAGCTCCAAGCTTCACA
TGGAGATGGATCACCCAGCAAATATGCAGTATACAGTATATGGATATGCTATGAACATGT
AGTCTCCCTCTTCTCTCACACACACACCCAGATACGTACACACAAAAATGGAGCTATTCT
CATCACAGCAATGGCTAGCACTTCTACCTCCGATCATCCTCTGTATCCTTCTGTTCTCCT
ATGTGTATATCATTCTATGGCTAAGACCAGAGCGGTTGAGGCAGAAACTGAGGAGCCAAG
GAGTGAGGGGTCCCAAGCCTTCTTTTCTCTTTGGAAACATACCAGAGATGAGGAGAATCC
AGCAATTGGCCAAGTCAGCACATGAACAAGAAGCAGGGAGTACCGACATGTTTTCATCAA
ATTATGTGGCAACTCTTTTCCCTTACTTCCTCCACTGGAGCAGGGTTTATGGTTCCATCT
ACCTGTATTCCACTGGAAGCATACAAGTTTTAAATGTTACTGATCCAAACATGGTGAAGG
AGCTAGCCAACTGCAAATCTTTGGATCTTGGAAAACCTTGCTACTTGCAAAAAGAGCGTG
GAGCTCTTCTTGGTATGGGAATTCTGACATCAAATGGTGATCTATGGGTACACCAGAGAA
AAGTGATTGCACCTGAACTATTCATGGAAAGGGTTAAGGGAATGGTGAATTTGATGATGG
AGGCTGCAATGTCAATGTTGAACTCATGGAAAAATGAAGTTGAGGACAGAGGAGGCAGTG
CAGAGATTGTGGTTGATGAGTTCTTGAGAACCTTTTCAGCTGATGTCATATCAAGGGCTT
GTTTTGGAAGCAGCTTTAGTGAAGGCAAGGAGATTTTCATAAAAATACGACAACTTCAGA
AAGCAATGGCAAAACAAAGTATGCTCATTGGTGTTCCTGGAAGTAGGTATTTACCAACAA
GGAGCAATAGAGGGATCTGGAATCTGGATAGTAGCATCCGTACCCTCATTTTAAACATAT
CAAAGAAATATGAACATGATTCATCGACCTCAGTAAACAAGGATCTCCTGCACTCCATTA
TTCAAGGTTCTAAGGATGGTCCCTTTGCTTCATGCACGCCCGAGGATTTCATCGTCGACA
ACTGCAAAAACATCTACTTCGCAGGGCATGAGACAACTTCGACCACGGCTGCTTGGTGTT
TGATGCTTCTAGCTTCACACCATGAATGGCAGTCCCGTGCCCGGGTGGAATCCCTTGACA
TTTGTCAAGGGAGACCACTAGATTTTGACATTCTACGGAAGTTGAAAAAGCTGACAATGG
TGATCCAGGAGACACTCCGATTGTACCCACCAGCCTCCTTCGTCGCCCGGGAAGCTCTGA
ATGACATGAAACTTGGCGGCATCGACATACCGAAAGGAACTAACATCTGGATCCCGATCG
CGATGGCTCACCGGGATCCTTCAGTATGGGGTCCTAGTGCCGACAAATTCGATCCGGACA
GGTTCGCCAACGGCATAGCAGGGGCCTGCAAACCCCCTCATATGTACATGCCCTTCGGCG
TTGGGGTCCGGACATGTGCCGGCCAGAATCTAGCCATGGTTGAGCTCAAGGTTGTTCTGT
CACTCCTGCTGTCCAAGTTTGAATTCAAGCTTTCTCCAAACTATGTGCATTGCCCTGCGT
TCAGACTGACCATCGAGCCTGGGAAAGGTGTTCCATTAATTTTTAGAGAGCTCTGACTTG
AGATTCTTGAAGGTTATATAAATGTTTCCCTTTTCCCCTTGTTATATTTGTTTGGTATGT
GTTTGCAACAATGCTGCAACTCGAGTGTAAACAGTAGTATATTCTACAGTATGCAATTCT
GTACACCGATTGAAGTGTTACTTATTTGTGGAATGAAACTTTTACTTCTCGTCTGTC

CDS

1569 bp

>Os12t0119000-01 Cytochrome P450 family protein.
ATGGAGCTATTCTCATCACAGCAATGGCTAGCACTTCTACCTCCGATCATCCTCTGTATC
CTTCTGTTCTCCTATGTGTATATCATTCTATGGCTAAGACCAGAGCGGTTGAGGCAGAAA
CTGAGGAGCCAAGGAGTGAGGGGTCCCAAGCCTTCTTTTCTCTTTGGAAACATACCAGAG
ATGAGGAGAATCCAGCAATTGGCCAAGTCAGCACATGAACAAGAAGCAGGGAGTACCGAC
ATGTTTTCATCAAATTATGTGGCAACTCTTTTCCCTTACTTCCTCCACTGGAGCAGGGTT
TATGGTTCCATCTACCTGTATTCCACTGGAAGCATACAAGTTTTAAATGTTACTGATCCA
AACATGGTGAAGGAGCTAGCCAACTGCAAATCTTTGGATCTTGGAAAACCTTGCTACTTG
CAAAAAGAGCGTGGAGCTCTTCTTGGTATGGGAATTCTGACATCAAATGGTGATCTATGG
GTACACCAGAGAAAAGTGATTGCACCTGAACTATTCATGGAAAGGGTTAAGGGAATGGTG
AATTTGATGATGGAGGCTGCAATGTCAATGTTGAACTCATGGAAAAATGAAGTTGAGGAC
AGAGGAGGCAGTGCAGAGATTGTGGTTGATGAGTTCTTGAGAACCTTTTCAGCTGATGTC
ATATCAAGGGCTTGTTTTGGAAGCAGCTTTAGTGAAGGCAAGGAGATTTTCATAAAAATA
CGACAACTTCAGAAAGCAATGGCAAAACAAAGTATGCTCATTGGTGTTCCTGGAAGTAGG
TATTTACCAACAAGGAGCAATAGAGGGATCTGGAATCTGGATAGTAGCATCCGTACCCTC
ATTTTAAACATATCAAAGAAATATGAACATGATTCATCGACCTCAGTAAACAAGGATCTC
CTGCACTCCATTATTCAAGGTTCTAAGGATGGTCCCTTTGCTTCATGCACGCCCGAGGAT
TTCATCGTCGACAACTGCAAAAACATCTACTTCGCAGGGCATGAGACAACTTCGACCACG
GCTGCTTGGTGTTTGATGCTTCTAGCTTCACACCATGAATGGCAGTCCCGTGCCCGGGTG
GAATCCCTTGACATTTGTCAAGGGAGACCACTAGATTTTGACATTCTACGGAAGTTGAAA
AAGCTGACAATGGTGATCCAGGAGACACTCCGATTGTACCCACCAGCCTCCTTCGTCGCC
CGGGAAGCTCTGAATGACATGAAACTTGGCGGCATCGACATACCGAAAGGAACTAACATC
TGGATCCCGATCGCGATGGCTCACCGGGATCCTTCAGTATGGGGTCCTAGTGCCGACAAA
TTCGATCCGGACAGGTTCGCCAACGGCATAGCAGGGGCCTGCAAACCCCCTCATATGTAC
ATGCCCTTCGGCGTTGGGGTCCGGACATGTGCCGGCCAGAATCTAGCCATGGTTGAGCTC
AAGGTTGTTCTGTCACTCCTGCTGTCCAAGTTTGAATTCAAGCTTTCTCCAAACTATGTG
CATTGCCCTGCGTTCAGACTGACCATCGAGCCTGGGAAAGGTGTTCCATTAATTTTTAGA
GAGCTCTGA

Protein

523 aa

>Os12t0119000-01 Cytochrome P450 family protein.
MELFSSQQWLALLPPIILCILLFSYVYIILWLRPERLRQKLRSQGVRGPKPSFLFGNIPE
MRRIQQLAKSAHEQEAGSTDMFSSNYVATLFPYFLHWSRVYGSIYLYSTGSIQVLNVTDP
NMVKELANCKSLDLGKPCYLQKERGALLGMGILTSNGDLWVHQRKVIAPELFMERVKGMV
NLMMEAAMSMLNSWKNEVEDRGGSAEIVVDEFLRTFSADVISRACFGSSFSEGKEIFIKI
RQLQKAMAKQSMLIGVPGSRYLPTRSNRGIWNLDSSIRTLILNISKKYEHDSSTSVNKDL
LHSIIQGSKDGPFASCTPEDFIVDNCKNIYFAGHETTSTTAAWCLMLLASHHEWQSRARV
ESLDICQGRPLDFDILRKLKKLTMVIQETLRLYPPASFVAREALNDMKLGGIDIPKGTNI
WIPIAMAHRDPSVWGPSADKFDPDRFANGIAGACKPPHMYMPFGVGVRTCAGQNLAMVEL
KVVLSLLLSKFEFKLSPNYVHCPAFRLTIEPGKGVPLIFREL*

5'UTR

chr12:912504..912656 (+ strand) : 153 bp

chr12:913118..913311 (+ strand) : 194 bp

CDS

chr12:913312..913615 (+ strand) : 304 bp

chr12:914145..914371 (+ strand) : 227 bp

chr12:914507..914754 (+ strand) : 248 bp

chr12:915293..915656 (+ strand) : 364 bp

chr12:915758..916183 (+ strand) : 426 bp

3'UTR

chr12:916184..916364 (+ strand) : 181 bp

FASTA

>Os12t0119000-01 class=Sequence position=chr12:912504..916364 (+ strand)
GATTCTTCTT AATCAGTCAG TTTCCTCATC CTCTTTGCAT CCTCCGCGCC CTCGCGCTGA TACTTGTAAT CAATCAACTC
ATCAGCATGG TCTTCGCATG GAGCTGCTAG CTGCAGAGTC ACAGAGCCCA ATTGTTGAGC TCGAAATGCC ACGGTGCGTG
CCCTCACTCA TCTCATCTCA TTTATTTTCT TAGTGCAGGC TAACACTTCC TTTAATAACT TGTGTGGGGA ATGAATTGAG
TCCTCTACTC TTAGCAGAGG CCCGTAGTTT TTTATTCAAG CAACCAATTG ATGTTATCTC TCTATATTCT AGCAGCCTCT
AGGCTACTAT ATGTCTATAT CTTGTGCAAT TTCTTGCCAA ATTAATGGGG CTAAACTATC ATACAACATC ATGCCGAAAA
GTCTTAATTT ATTGTTTGTT GAAAGCTCTT TACTACAAGG TTATTGCCCA ACCTCATAAT CTGTTGAAGA TATATGAAAC
CCCCAAATTG TTCCTTTTTA TGCCATGTGA ATAATTTGGT CATAACAGAC CCTGGTTTCC TTAAAAAAAT GCATGTTAAA
TTAAGTTTTC CTACCACTAA CCTTGGATTT CTTTTCTATG TTGTAAATTT GCAGTGTTGT ATGATCGTTA CATGCTAACT
GCTCAGAGTG AGTGAGGCGC TTCTTTGCGG CTTTATGTCC TTTTCAGCTC CAAGCTTCAC ATGGAGATGG ATCACCCAGC
AAATATGCAG TATACAGTAT ATGGATATGC TATGAACATG TAGTCTCCCT CTTCTCTCAC ACACACACCC AGATACGTAC
ACACAAAAAT GGAGCTATTC TCATCACAGC AATGGCTAGC ACTTCTACCT CCGATCATCC TCTGTATCCT TCTGTTCTCC
TATGTGTATA TCATTCTATG GCTAAGACCA GAGCGGTTGA GGCAGAAACT GAGGAGCCAA GGAGTGAGGG GTCCCAAGCC
TTCTTTTCTC TTTGGAAACA TACCAGAGAT GAGGAGAATC CAGCAATTGG CCAAGTCAGC ACATGAACAA GAAGCAGGGA
GTACCGACAT GTTTTCATCA AATTATGTGG CAACTCTTTT CCCTTACTTC CTCCACTGGA GCAGGGTTTA TGGTACGTTA
AGAAACTTGT AGTGCATAAT AGTTTCAGTA AAATAAAGTT TATTAATTCA TCTTTATATT CGATGTTAAA TGTAATTCAT
TGGAATTTTG TTAAGAGGAA TGTTTTGATA TTGACTTATT TTTTCTCTAA AATTTCTCTT TTTATTGTCC CACATAACAG
GATTGTTTTT ATTTTGGGGT GATGCAAACT TGAATTCAGA GAGTTTTAGG TACCTTTGTA TTTTGGATGG TAGTTCGCTC
TGCAACCATC GAAACATAAT TTCTTTGATT GGGGCCTGTT TATGGATAGC TCATGGTTTC ATATACGTTC TGATGGTGTA
CCATATACTG TCTCATCTTG TCGACCAGTC TCATTGTTAC CCTCATTACA TATAAGCTAT TTAAATTACT GTAAATTCTT
TTGTTGTATG TTCTGTAACC ATGTCCTAAT AGATTTATTT TTAGAACATC GACGGATGCC TTGTGCATTT CATATTTAAA
ATTAAAGCTG ATAAGTTCCT GAAACATTGA TGTTGTGTTA GGTTCCATCT ACCTGTATTC CACTGGAAGC ATACAAGTTT
TAAATGTTAC TGATCCAAAC ATGGTGAAGG AGCTAGCCAA CTGCAAATCT TTGGATCTTG GAAAACCTTG CTACTTGCAA
AAAGAGCGTG GAGCTCTTCT TGGTATGGGA ATTCTGACAT CAAATGGTGA TCTATGGGTA CACCAGAGAA AAGTGATTGC
ACCTGAACTA TTCATGGAAA GGGTTAAGGT AATTATCTGC AGGCACTTGT ATTGGGCCAT GGATCTCTCT GTCAAAAAAC
AATATTTTTC TTGGAGCAAC TTTCTAGTAC ACTACATGTA GCATATACTA AAACTCAATT TATTGTTAAA ATGACATCCA
TAGGGAATGG TGAATTTGAT GATGGAGGCT GCAATGTCAA TGTTGAACTC ATGGAAAAAT GAAGTTGAGG ACAGAGGAGG
CAGTGCAGAG ATTGTGGTTG ATGAGTTCTT GAGAACCTTT TCAGCTGATG TCATATCAAG GGCTTGTTTT GGAAGCAGCT
TTAGTGAAGG CAAGGAGATT TTCATAAAAA TACGACAACT TCAGAAAGCA ATGGCAAAAC AAAGTATGCT CATTGGTGTT
CCTGGAAGTA GGTATATTTC AGAAACTACA CATGTACTAC TGTGGCACAT ATTTCAATTT GAGACAATTT AAAACTCAAA
AGAATGCTGT CTTTGAACTG CTCAAAATCC TCTGTTGAGC TCTTTTTTTA GATAATGCTT AGTTTGAATG ATTTCAATAC
CCAAGTAGCT GCCCAGATTC AACTTCTGAA ATCACTATAA TTCAGATAAT GTGTTACTGT TTTGGTTTGC AGCAGTATCA
GAATAACCTT TTGGAGAAAT ATACAGCTTC TATTTTGTCT GGGCTAACTT ACATGTCCCA TTTTGGTCTG ATCTACCTGC
AATTCCTACA TATCATTCTA AATGGATATA AGGCCTAAAA AATAATATTT TATCTAGAAT CCGTGAGATA CTACAGTAGA
TCCAAGAGTA TCATAACATG TATTTTCCAA TCCATACCAT TGCATGAGAA TAATTATATG AAAATAAGTG GCTTCTCATG
TTTTATCATC TTATTGTAAT TGGTTAATCA TTTAAGGATT TTCCTTTATT TTTGTGCTGG GCCGACTAGG TATTTACCAA
CAAGGAGCAA TAGAGGGATC TGGAATCTGG ATAGTAGCAT CCGTACCCTC ATTTTAAACA TATCAAAGAA ATATGAACAT
GATTCATCGA CCTCAGTAAA CAAGGATCTC CTGCACTCCA TTATTCAAGG TTCTAAGGAT GGTCCCTTTG CTTCATGCAC
GCCCGAGGAT TTCATCGTCG ACAACTGCAA AAACATCTAC TTCGCAGGGC ATGAGACAAC TTCGACCACG GCTGCTTGGT
GTTTGATGCT TCTAGCTTCA CACCATGAAT GGCAGTCCCG TGCCCGGGTG GAATCCCTTG ACATTTGTCA AGGGAGACCA
CTAGATTTTG ACATTCTACG GAAGTTGAAA AAGGTATGTT TTGTCCTCTC ATCCTCTTCC AGTAACAGAA GAGATGAAAA
CAATCCGTTC ATTAGATTAC AGCTAACAAT GGTGTGCTGT TGATACTTGT GCAGCTGACA ATGGTGATCC AGGAGACACT
CCGATTGTAC CCACCAGCCT CCTTCGTCGC CCGGGAAGCT CTGAATGACA TGAAACTTGG CGGCATCGAC ATACCGAAAG
GAACTAACAT CTGGATCCCG ATCGCGATGG CTCACCGGGA TCCTTCAGTA TGGGGTCCTA GTGCCGACAA ATTCGATCCG
GACAGGTTCG CCAACGGCAT AGCAGGGGCC TGCAAACCCC CTCATATGTA CATGCCCTTC GGCGTTGGGG TCCGGACATG
TGCCGGCCAG AATCTAGCCA TGGTTGAGCT CAAGGTTGTT CTGTCACTCC TGCTGTCCAA GTTTGAATTC AAGCTTTCTC
CAAACTATGT GCATTGCCCT GCGTTCAGAC TGACCATCGA GCCTGGGAAA GGTGTTCCAT TAATTTTTAG AGAGCTCTGA
CTTGAGATTC TTGAAGGTTA TATAAATGTT TCCCTTTTCC CCTTGTTATA TTTGTTTGGT ATGTGTTTGC AACAATGCTG
CAACTCGAGT GTAAACAGTA GTATATTCTA CAGTATGCAA TTCTGTACAC CGATTGAAGT GTTACTTATT TGTGGAATGA
AACTTTTACT TCTCGTCTGT C

Locus: Os12g0119000

Loading...

Locus: Os12g0119000

Loading...