Os12t0122000-01

Locus

Os12g0122000

Description

Transcription factor, Asymmetric division of the cortex/endodermis progenitor cell in the root, Formation of root endodermis and leaf stomata

RAP-DB Gene Symbol Synonym(s)

OsSCR2, OsSCR

RAP-DB Gene Name Synonym(s)

SCARECROW

CGSNL Gene Symbol

SCR

CGSNL Gene Name

SCARECROW GENE

Oryzabase Gene Symbol Synonym(s)

OsSCR, OsSCR2, SCR2, OsGRAS-51, OsGRAS51, GRAS-51, GRAS51

Oryzabase Gene Name Synonym(s)

rice SCARECROW gene, SCARECROW, Protein SCARECROW 2, GRAS protein 51

Transcript Evidence

AK243131

Protein Evidence

Q2QYF3

Literature

PMID: 17446396

PMID: 25352666

PMID: 12974810

Note

Manual Curation

February 20, 2018

Functional domain (InterPro)

Transcription factor GRAS (IPR005202)

Full-length cDNA

J100030A12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0122000-01)

Others

Oryzabase (3119)

KEGG (Os12t0122000-01)

Transcript

2397 bp

>Os12t0122000-01 Transcription factor, Asymmetric division of the cortex/endodermis progenitor cell in the root, Formation of root endodermis and leaf stomata
GCGCCGCGCCAAATTCCATAAAAATTCCACCCAACACAAGCGTTAGGCCTCCCGCGCACG
CCCGTCCGCTCGCCATGCCCACGGCCTCTTCCCCTTGGCGTTTGTAGATGGGCTCCTCCT
CCCTCCTCCTCTTCCCCTCCTCTTCCTCCTCCGCCACCCACTCCTCTTATTCTCCCTCCT
CCTCCTCTCATGCCATCACCTCCTTGCTGCCTCCTCTCCCCTCCGACCACCATCTCCTCC
TCTACCTAGACCACCAAGAACAACACCACCTCGCCGCCGCCATGGTCCGCAAGCGCCCCG
CCTCCGACATGGACCTGCCACCGCCGCGCCGCCATGTCACCGGCGACCTGTCCGATGTCA
CGGCCGCCGCGGCGGGCGCGCCGACGTTGTCTGCCAGCGCGCAGCTCCCCGCGCTGCCCA
CGCAGCTCCCGGCGTTCCACCACACGGACATGGACCTCGCCGCGCCCGCGCCGCCGGCGC
CGCAGCAGGTGGCGGCGGGTGAGGGTGGGCCGCCCAGCACGGCTTGGGTGGATGGCATCA
TCCGTGACATCATCGCCAGCAGCGGCGCCGCGGTCTCCGTCGCGCAGCTCATCCACAACG
TGCGTGAGATCATCCGGCCATGTAACCCCGACCTCGCGTCCATCCTCGAGCTCCGCCTCC
GCTCTCTCCTCAACTCCGACCCCGCGCCGCCGCCGCCGCCGCCGTCGCATCCTGCTCTCC
TCCCTCCCGACGCCACGGCGCCACCGCCACCACCCACGTCGGTCGCCGCGCTCCCTCCCC
CTCCGCCAGCGCAGcccgacaagcggcgtcgcgagcctcagtgtcaggagcaggagccca
accagccgcagtcgccgaagccccccaccgcggaggaaaccgccgccgccgccgcggccg
ccgcagcggcggctgccgcggccgccaaggagcGTAAGGAGGagcagcggcggaagcagc
gcgacgaggagggcctccacttgctgacgctgctgctccaGTGCGCGGAGTCGGTGAACG
CGGACAACCTGGACGAGGCGCACCGCGCGCTGCTGGAGATCGCGGAGCTCGCCACGCCGT
TCGGCACCTCGACGCAGCGCGTGGCGGCCTACTTCGCGGAGGCCATGTCGGCGCGGCTGG
TGAGCTCGTGCCTGGGGCTGTACGCGCCGCTCCCGAGCCCGTCCCCGGCGGGCGCGCGGG
TCCACGGGCGCGTGGCGGCGGCGTTCCAGGTGTTCAACGGGATCAGCCCGTTCGTGAAGT
TCTCGCACTTCACGGCGAACCAGGCGATCCAGGAGGCGTTCGAGAGGGAGGAGAGGGTGC
ACATCATCGACCTGGACATCATGCAGGGGCTCCAATGGCCGGGGCTGTTCCACATCCTGG
CGTCGCGGCCGGGGGGGCCGCCGAGGGTGAGGCTGACCGGGCTGGGGGCGTCCATGGAGG
CGCTGGAGGCGACGGGGAAGAGGCTGTCGGACTTCGCGGACACGCTGGGATTGCCGTTCG
AGTTCTGCCCGGTGGCTGACAAGGCCGGGAATCTGGACCCGGAGAAGCTGGGCGTCACGC
GCCGCGAGGCCGTCGCCGTCCACTGGCTGCGCCACTCCCTCTACGATGTCACCGGCTCCG
ACTCCAACACGCTCTGGCTCATCCAGAGGTTGGCGCCAAAGGTTGTAACAATGGTGGAGC
AGGATCTGAGCCACTCAGGCTCCTTCCTGGCACGTTTTGTGGAGGCCATCCACTACTATT
CGGCACTGTTCGACTCGCTTGATGCGAGTTACAGCGAGGATAGCCCGGAGCGGCATGTCG
TGGAGCAACAACTCTTGTCGCGGGAGATCCGCAATGTGCTAGCCGTGGGCGGTCCAGCAC
GCACCGGCGATGTTAAGTTTGGGAGCTGGCGCGAAAAGCTTGCGCAGTCGGGCTTCCGTG
TGTCGTCGCTTGCTGGAAGCGCTGCTGCTCAGGCTGCACTGCTGCTTGGGATGTTCCCTT
CCGATGGATACACGCTTATTGAGGAGAATGGCGCTCTGAAGCTCGGATGGAAGGATCTGT
GCCTTCTCACTGCCTCTGCTTGGCGCCCAATTCAGGCTTCGGGACGTTAGTATTGAGGGG
GAATTTATAGAGCTGAAGTATCACTTGATCTTACTTAGGTGCAATTACCTAGTCCTTTTG
CTTCTTTTAGCTGCTCAATTTGGTCAATTCTGAGAAAAGAAAAATAAAAAAAAATTCTGA
TCACTAATTTTCAGATCTCCACACAGTGGTAGTTACTAATGTGCAACTTAGCTTTAGCTT
TTATTCTGTTCATGCTCCAGTTAACCATTCTGTCCAATTTAGTTTATTTTGCAATTTTGT
AGTGCTTAATCCTTGCTGACATTGTTTTGGGGGAACACGCAAAAGGATCCTTACTGA

CDS

1983 bp

>Os12t0122000-01 Transcription factor, Asymmetric division of the cortex/endodermis progenitor cell in the root, Formation of root endodermis and leaf stomata
ATGGGCTCCTCCTCCCTCCTCCTCTTCCCCTCCTCTTCCTCCTCCGCCACCCACTCCTCT
TATTCTCCCTCCTCCTCCTCTCATGCCATCACCTCCTTGCTGCCTCCTCTCCCCTCCGAC
CACCATCTCCTCCTCTACCTAGACCACCAAGAACAACACCACCTCGCCGCCGCCATGGTC
CGCAAGCGCCCCGCCTCCGACATGGACCTGCCACCGCCGCGCCGCCATGTCACCGGCGAC
CTGTCCGATGTCACGGCCGCCGCGGCGGGCGCGCCGACGTTGTCTGCCAGCGCGCAGCTC
CCCGCGCTGCCCACGCAGCTCCCGGCGTTCCACCACACGGACATGGACCTCGCCGCGCCC
GCGCCGCCGGCGCCGCAGCAGGTGGCGGCGGGTGAGGGTGGGCCGCCCAGCACGGCTTGG
GTGGATGGCATCATCCGTGACATCATCGCCAGCAGCGGCGCCGCGGTCTCCGTCGCGCAG
CTCATCCACAACGTGCGTGAGATCATCCGGCCATGTAACCCCGACCTCGCGTCCATCCTC
GAGCTCCGCCTCCGCTCTCTCCTCAACTCCGACCCCGCGCCGCCGCCGCCGCCGCCGTCG
CATCCTGCTCTCCTCCCTCCCGACGCCACGGCGCCACCGCCACCACCCACGTCGGTCGCC
GCGCTCCCTCCCCCTCCGCCAGCGCAGcccgacaagcggcgtcgcgagcctcagtgtcag
gagcaggagcccaaccagccgcagtcgccgaagccccccaccgcggaggaaaccgccgcc
gccgccgcggccgccgcagcggcggctgccgcggccgccaaggagcGTAAGGAGGagcag
cggcggaagcagcgcgacgaggagggcctccacttgctgacgctgctgctccaGTGCGCG
GAGTCGGTGAACGCGGACAACCTGGACGAGGCGCACCGCGCGCTGCTGGAGATCGCGGAG
CTCGCCACGCCGTTCGGCACCTCGACGCAGCGCGTGGCGGCCTACTTCGCGGAGGCCATG
TCGGCGCGGCTGGTGAGCTCGTGCCTGGGGCTGTACGCGCCGCTCCCGAGCCCGTCCCCG
GCGGGCGCGCGGGTCCACGGGCGCGTGGCGGCGGCGTTCCAGGTGTTCAACGGGATCAGC
CCGTTCGTGAAGTTCTCGCACTTCACGGCGAACCAGGCGATCCAGGAGGCGTTCGAGAGG
GAGGAGAGGGTGCACATCATCGACCTGGACATCATGCAGGGGCTCCAATGGCCGGGGCTG
TTCCACATCCTGGCGTCGCGGCCGGGGGGGCCGCCGAGGGTGAGGCTGACCGGGCTGGGG
GCGTCCATGGAGGCGCTGGAGGCGACGGGGAAGAGGCTGTCGGACTTCGCGGACACGCTG
GGATTGCCGTTCGAGTTCTGCCCGGTGGCTGACAAGGCCGGGAATCTGGACCCGGAGAAG
CTGGGCGTCACGCGCCGCGAGGCCGTCGCCGTCCACTGGCTGCGCCACTCCCTCTACGAT
GTCACCGGCTCCGACTCCAACACGCTCTGGCTCATCCAGAGGTTGGCGCCAAAGGTTGTA
ACAATGGTGGAGCAGGATCTGAGCCACTCAGGCTCCTTCCTGGCACGTTTTGTGGAGGCC
ATCCACTACTATTCGGCACTGTTCGACTCGCTTGATGCGAGTTACAGCGAGGATAGCCCG
GAGCGGCATGTCGTGGAGCAACAACTCTTGTCGCGGGAGATCCGCAATGTGCTAGCCGTG
GGCGGTCCAGCACGCACCGGCGATGTTAAGTTTGGGAGCTGGCGCGAAAAGCTTGCGCAG
TCGGGCTTCCGTGTGTCGTCGCTTGCTGGAAGCGCTGCTGCTCAGGCTGCACTGCTGCTT
GGGATGTTCCCTTCCGATGGATACACGCTTATTGAGGAGAATGGCGCTCTGAAGCTCGGA
TGGAAGGATCTGTGCCTTCTCACTGCCTCTGCTTGGCGCCCAATTCAGGCTTCGGGACGT
TAG

Protein

661 aa

>Os12t0122000-01 Transcription factor, Asymmetric division of the cortex/endodermis progenitor cell in the root, Formation of root endodermis and leaf stomata
MGSSSLLLFPSSSSSATHSSYSPSSSSHAITSLLPPLPSDHHLLLYLDHQEQHHLAAAMV
RKRPASDMDLPPPRRHVTGDLSDVTAAAAGAPTLSASAQLPALPTQLPAFHHTDMDLAAP
APPAPQQVAAGEGGPPSTAWVDGIIRDIIASSGAAVSVAQLIHNVREIIRPCNPDLASIL
ELRLRSLLNSDPAPPPPPPSHPALLPPDATAPPPPPTSVAALPPPPPAQPDKRRREPQCQ
EQEPNQPQSPKPPTAEETAAAAAAAAAAAAAAAKERKEEQRRKQRDEEGLHLLTLLLQCA
ESVNADNLDEAHRALLEIAELATPFGTSTQRVAAYFAEAMSARLVSSCLGLYAPLPSPSP
AGARVHGRVAAAFQVFNGISPFVKFSHFTANQAIQEAFEREERVHIIDLDIMQGLQWPGL
FHILASRPGGPPRVRLTGLGASMEALEATGKRLSDFADTLGLPFEFCPVADKAGNLDPEK
LGVTRREAVAVHWLRHSLYDVTGSDSNTLWLIQRLAPKVVTMVEQDLSHSGSFLARFVEA
IHYYSALFDSLDASYSEDSPERHVVEQQLLSREIRNVLAVGGPARTGDVKFGSWREKLAQ
SGFRVSSLAGSAAAQAALLLGMFPSDGYTLIEENGALKLGWKDLCLLTASAWRPIQASGR
*

5'UTR

chr12:1043608..1043714 (+ strand) : 107 bp

CDS

chr12:1043715..1045255 (+ strand) : 1541 bp

chr12:1046368..1046809 (+ strand) : 442 bp

3'UTR

chr12:1046810..1047116 (+ strand) : 307 bp

FASTA

>Os12t0122000-01 class=Sequence position=chr12:1043608..1047116 (+ strand)
GCGCCGCGCC AAATTCCATA AAAATTCCAC CCAACACAAG CGTTAGGCCT CCCGCGCACG CCCGTCCGCT CGCCATGCCC
ACGGCCTCTT CCCCTTGGCG TTTGTAGATG GGCTCCTCCT CCCTCCTCCT CTTCCCCTCC TCTTCCTCCT CCGCCACCCA
CTCCTCTTAT TCTCCCTCCT CCTCCTCTCA TGCCATCACC TCCTTGCTGC CTCCTCTCCC CTCCGACCAC CATCTCCTCC
TCTACCTAGA CCACCAAGAA CAACACCACC TCGCCGCCGC CATGGTCCGC AAGCGCCCCG CCTCCGACAT GGACCTGCCA
CCGCCGCGCC GCCATGTCAC CGGCGACCTG TCCGATGTCA CGGCCGCCGC GGCGGGCGCG CCGACGTTGT CTGCCAGCGC
GCAGCTCCCC GCGCTGCCCA CGCAGCTCCC GGCGTTCCAC CACACGGACA TGGACCTCGC CGCGCCCGCG CCGCCGGCGC
CGCAGCAGGT GGCGGCGGGT GAGGGTGGGC CGCCCAGCAC GGCTTGGGTG GATGGCATCA TCCGTGACAT CATCGCCAGC
AGCGGCGCCG CGGTCTCCGT CGCGCAGCTC ATCCACAACG TGCGTGAGAT CATCCGGCCA TGTAACCCCG ACCTCGCGTC
CATCCTCGAG CTCCGCCTCC GCTCTCTCCT CAACTCCGAC CCCGCGCCGC CGCCGCCGCC GCCGTCGCAT CCTGCTCTCC
TCCCTCCCGA CGCCACGGCG CCACCGCCAC CACCCACGTC GGTCGCCGCG CTCCCTCCCC CTCCGCCAGC GCAGcccgac
aagcggcgtc gcgagcctca gtgtcaggag caggagccca accagccgca gtcgccgaag ccccccaccg cggaggaaac
cgccgccgcc gccgcggccg ccgcagcggc ggctgccgcg gccgccaagg agcGTAAGGA GGagcagcgg cggaagcagc
gcgacgagga gggcctccac ttgctgacgc tgctgctcca GTGCGCGGAG TCGGTGAACG CGGACAACCT GGACGAGGCG
CACCGCGCGC TGCTGGAGAT CGCGGAGCTC GCCACGCCGT TCGGCACCTC GACGCAGCGC GTGGCGGCCT ACTTCGCGGA
GGCCATGTCG GCGCGGCTGG TGAGCTCGTG CCTGGGGCTG TACGCGCCGC TCCCGAGCCC GTCCCCGGCG GGCGCGCGGG
TCCACGGGCG CGTGGCGGCG GCGTTCCAGG TGTTCAACGG GATCAGCCCG TTCGTGAAGT TCTCGCACTT CACGGCGAAC
CAGGCGATCC AGGAGGCGTT CGAGAGGGAG GAGAGGGTGC ACATCATCGA CCTGGACATC ATGCAGGGGC TCCAATGGCC
GGGGCTGTTC CACATCCTGG CGTCGCGGCC GGGGGGGCCG CCGAGGGTGA GGCTGACCGG GCTGGGGGCG TCCATGGAGG
CGCTGGAGGC GACGGGGAAG AGGCTGTCGG ACTTCGCGGA CACGCTGGGA TTGCCGTTCG AGTTCTGCCC GGTGGCTGAC
AAGGCCGGGA ATCTGGACCC GGAGAAGCTG GGCGTCACGC GCCGCGAGGC CGTCGCCGTC CACTGGCTGC GCCACTCCCT
CTACGATGTC ACCGGCTCCG ACTCCAACAC GCTCTGGCTC ATCCAGAGGT ACTACACTTT TCTTCTCTCT TCCCTTGTCA
ACTCGGGACC CCCCGGAATC ATGGCTACTT TACACCCTAT ACTTCTCATT GACATTGTGA CCTAGTAGTA TACTCTATCT
ATGCATCATC ATATCAGTGG TTAGTAGTAC TAGCCCTAGA TCACCATAGG ATGATTAAGG AGGAGTAAAA AAAGATTTGC
GTTTTGGAGC CCTAAggcca gtcacaatgg gggtttcact ggtgtgtcat gcacatttaa taggggtaag actgaataaa
aaatgattat ttgcatgaaa tggggatgag agagaaggaa agagtttcat cctggtgaaa ctcgtcagcg tcgtttccaa
gtcctcggta acagagtgaa acccccgttg aggccgattc gtttcattca ccggatctct tgcgtccgcc tccgccgtgc
gacctccgca ttctcccgcg ccgcgccgga ttttgggtac aaatgatccc agcaacttgt atcaattaaa tgctttgctt
agtcttggaa acgtcaaagt gaaacccctc cactgtgggg attgtttcat aaaagatttc atttgagaga agatggtata
atattttggg tagccgtgca atgacactag ccattgtgac tggccTAAAA GTATGTCATT ATGGCCAACT TTTTAGGCTT
AGAAAGGTTG CAACTTTCTA GTGGTTCTGT GGTATCAAGC TTCTCCATGG TCTTTGGTGA TCCGAGAAGT GGGAAAGATT
TCTCCTCCAT TTGGTTTGTG GATCACTATG AACGAGCTAA AAGTTCTTAT CATCATGACC AACTTTTCAT GCCAAAAGGT
CTCAGCTTTC TAGTTCTAAG TGCCACCAAT GTTGATTATT AAATTGAAAT GGCTGCAATC TATACACAGT TCATACTAGA
GATCACATAG TAGTGGACTG CAATAGATAT GTCCCACTGT ACTTGCAAAA ACCATGAAGG CAAGGCAACC AATTTAGGTG
TCCTTGAGAA CTTATTGTTA TCATTTATAG TTCTAAATGT TGCTAGTTGA GTCATTCTTG TCGAACAGAA TCATAATTAA
TTTGTGTACT GATCTTGACT CTGTGGACCA CACAAATCAG GTTGGCGCCA AAGGTTGTAA CAATGGTGGA GCAGGATCTG
AGCCACTCAG GCTCCTTCCT GGCACGTTTT GTGGAGGCCA TCCACTACTA TTCGGCACTG TTCGACTCGC TTGATGCGAG
TTACAGCGAG GATAGCCCGG AGCGGCATGT CGTGGAGCAA CAACTCTTGT CGCGGGAGAT CCGCAATGTG CTAGCCGTGG
GCGGTCCAGC ACGCACCGGC GATGTTAAGT TTGGGAGCTG GCGCGAAAAG CTTGCGCAGT CGGGCTTCCG TGTGTCGTCG
CTTGCTGGAA GCGCTGCTGC TCAGGCTGCA CTGCTGCTTG GGATGTTCCC TTCCGATGGA TACACGCTTA TTGAGGAGAA
TGGCGCTCTG AAGCTCGGAT GGAAGGATCT GTGCCTTCTC ACTGCCTCTG CTTGGCGCCC AATTCAGGCT TCGGGACGTT
AGTATTGAGG GGGAATTTAT AGAGCTGAAG TATCACTTGA TCTTACTTAG GTGCAATTAC CTAGTCCTTT TGCTTCTTTT
AGCTGCTCAA TTTGGTCAAT TCTGAGAAAA GAAAAATAAA AAAAAATTCT GATCACTAAT TTTCAGATCT CCACACAGTG
GTAGTTACTA ATGTGCAACT TAGCTTTAGC TTTTATTCTG TTCATGCTCC AGTTAACCAT TCTGTCCAAT TTAGTTTATT
TTGCAATTTT GTAGTGCTTA ATCCTTGCTG ACATTGTTTT GGGGGAACAC GCAAAAGGAT CCTTACTGA

Locus: Os12g0122000

Loading...

Locus: Os12g0122000

Loading...