Os12t0123700-01

Locus

Os12g0123700

Description

NAC domain containing transcription factor, Abiotic and biotic stress response

RAP-DB Gene Symbol Synonym(s)

NAC131, ONAC131

RAP-DB Gene Name Synonym(s)

NAC DOMAIN-CONTAINING PROTEIN 131, NAC domain-containing protein 131

CGSNL Gene Symbol

NAC131

CGSNL Gene Name

NAC DOMAIN-CONTAINING PROTEIN 131

Oryzabase Gene Symbol Synonym(s)

ONAC131

Oryzabase Gene Name Synonym(s)

NAC domain-containing protein 131

Transcript Evidence

Inferred from literature

Protein Evidence

Q2QYD5

Literature

PMID: 18813954

PMID: 20600702

Note

Manual Curation

April 10, 2015

Gene Ontology (GO)

Biological Process: regulation of transcription, DNA-templated (GO:0006355)

Molecular Function: DNA binding (GO:0003677)

Functional domain (InterPro)

NAC domain (IPR003441)

Expression Databases

TENOR (Os12t0123700-00)

Others

Oryzabase (15891)

Transcript

1945 bp

>Os12t0123700-01 NAC domain containing transcription factor, Abiotic and biotic stress response
AATTAGCTCTCATTAATCAATTGCTTTGTAGTAATCCATCCATGCACCCACCTCTCTTTC
TCCCGAACAGCAAGAAGATGAGCCAAGCCCATGGCGTCTATAAAAGAGAGCCCTACCCCC
TCCATCTCAAAAATTTCAATCCTTCCTCTTCCTTAGCTTATTAGCTTCCTTCCTTCACTA
GTGCCAGTTTTCCTCCTACGTAATCTAAGCTAGCCAGGTCGTCATCTTCTTCCTTCAGCT
CACGCTGACCAAACACCATCTGTTATTCTGTTTGTTTGTTTTTTTTTAAAAAAAGAAAAA
AAATCTAGCTAGGCGAGCCGATTGAAGGAGCTGAGCATGCCGAGCAGCGGCGGCGCCATG
CCTGCCcttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactac
ctcatgaaccaggccgcctccatcaagtgccccgtgccaatcatcgccgaggtcaacatc
tacaagtgcaacccatgggaccttcctggtaaggcgctgttcggcgagaacgaatggtac
ttcttcagcccgagggaccgcaagtaccccaacggcgcacgccccaaccgcgccgccggc
tcggggtactggaaggccaccggcaccgacaagtccatcttgtcaactccgacgagcgac
aacatcggcgtcaagaaggccctagtcttctacaagggcaagccccccaagggcgtcaag
accgactggatcatgcacgagtatcgcctcacAGGCACATCAGCTAACAACACCACCACC
ACAAAGCAGCGTAGAGCATCATCCATGACCATGAGGCTGGACGACTGGGTGCTGTGCAGA
ATCCACAAGAAGAGCAACGACTTCAATTCCTCTGACCAACACGACCAAGAACCCGAGGGA
TCAACCGTCGATGAACAGCTTGAAGACATCCATGACAACAACTCTTCCTCTCAACAACCT
CCTGCTCCACCTGACATGAACAACCAACAGTCAGATTTCCAGCCCATGACGGCGATGAGC
ATGAGCAAGTCATGCTCCCTCACCGATCTCCTCAACAACCTCGACTGCGCCGCGCTCTCG
CAGTTTCTCCTCGACGGCTCATCCGACGCCATCGCTGAGCTTCCTGCTCCTCCCAGCCCT
CTAATATATCCAAACCAAACACTAAACTATAACATCAACAACAACATGCCACACGCCTTC
GAGTCACGCCTAGATCATCACGATGGTTACGTTAACAATTATAATGTTAATGGCCTAAGG
AGGAAGAGAATGATGGCGTGTAGTGCAACTTCTTTTGATGATGGCAGCAGCAGCAGCAGC
AGTGACTTTTTGCATGTTGCCAAGAAACCGCTGCTGCTGCCAAGTGATTCAAGGGGCAGT
GGTTTTGGAGGAGGTTACTGCAACCAGCAGCTTTCAGAGACTGCGACTGGTTTTCAGTTT
CAGAACGGCAATATGTTGAGCCATCCATTTCCTCTGAACCAGCAGCTACTGCTGAACAAT
CATCTGCAGATGCAGTAGCTAGTAGGCGTCTAGATCCGTTTACCGATCGATCTGAAGAGA
GGTGAATTAATTTCAACGAATGAAACTACAGATTCAGAGAGGAAGATACTGATTGTTCCA
TTTGGATTTATTTTGAGGAGTTGCATGACAgatagacaaacagacggaattcttgatgta
acccatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttg
ttttcattttcatgtacaagaatgtaaattataaatgGTAATATCGTGCAAGCTAGTACT
CAAGCCAATTTATATGATAATCTTTATGCATGTTTCTTAATTATTCTGGTATCAAGCACA
CGAAAGAAACATGCTACTTTGTCGTTGATTCATTGGACCTTACAAATTAAACAATTTGTT
CTTGTCTGAATGTGCTGATATATAA

CDS

1182 bp

>Os12t0123700-01 NAC domain containing transcription factor, Abiotic and biotic stress response
ATGCCGAGCAGCGGCGGCGCCATGCCTGCCcttccaccaggcttccgcttccaccccacc
gacgaggagctcatcgttcactacctcatgaaccaggccgcctccatcaagtgccccgtg
ccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggcg
ctgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggc
gcacgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtcc
atcttgtcaactccgacgagcgacaacatcggcgtcaagaaggccctagtcttctacaag
ggcaagccccccaagggcgtcaagaccgactggatcatgcacgagtatcgcctcacAGGC
ACATCAGCTAACAACACCACCACCACAAAGCAGCGTAGAGCATCATCCATGACCATGAGG
CTGGACGACTGGGTGCTGTGCAGAATCCACAAGAAGAGCAACGACTTCAATTCCTCTGAC
CAACACGACCAAGAACCCGAGGGATCAACCGTCGATGAACAGCTTGAAGACATCCATGAC
AACAACTCTTCCTCTCAACAACCTCCTGCTCCACCTGACATGAACAACCAACAGTCAGAT
TTCCAGCCCATGACGGCGATGAGCATGAGCAAGTCATGCTCCCTCACCGATCTCCTCAAC
AACCTCGACTGCGCCGCGCTCTCGCAGTTTCTCCTCGACGGCTCATCCGACGCCATCGCT
GAGCTTCCTGCTCCTCCCAGCCCTCTAATATATCCAAACCAAACACTAAACTATAACATC
AACAACAACATGCCACACGCCTTCGAGTCACGCCTAGATCATCACGATGGTTACGTTAAC
AATTATAATGTTAATGGCCTAAGGAGGAAGAGAATGATGGCGTGTAGTGCAACTTCTTTT
GATGATGGCAGCAGCAGCAGCAGCAGTGACTTTTTGCATGTTGCCAAGAAACCGCTGCTG
CTGCCAAGTGATTCAAGGGGCAGTGGTTTTGGAGGAGGTTACTGCAACCAGCAGCTTTCA
GAGACTGCGACTGGTTTTCAGTTTCAGAACGGCAATATGTTGAGCCATCCATTTCCTCTG
AACCAGCAGCTACTGCTGAACAATCATCTGCAGATGCAGTAG

Protein

394 aa

>Os12t0123700-01 NAC domain containing transcription factor, Abiotic and biotic stress response
MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASIKCPVPIIAEVNIYKCNPWDLPGKA
LFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSILSTPTSDNIGVKKALVFYK
GKPPKGVKTDWIMHEYRLTGTSANNTTTTKQRRASSMTMRLDDWVLCRIHKKSNDFNSSD
QHDQEPEGSTVDEQLEDIHDNNSSSQQPPAPPDMNNQQSDFQPMTAMSMSKSCSLTDLLN
NLDCAALSQFLLDGSSDAIAELPAPPSPLIYPNQTLNYNINNNMPHAFESRLDHHDGYVN
NYNVNGLRRKRMMACSATSFDDGSSSSSSDFLHVAKKPLLLPSDSRGSGFGGGYCNQQLS
ETATGFQFQNGNMLSHPFPLNQQLLLNNHLQMQ*

5'UTR

chr12:1139026..1139361 (+ strand) : 336 bp

CDS

chr12:1139362..1139533 (+ strand) : 172 bp

chr12:1139661..1139968 (+ strand) : 308 bp

chr12:1140234..1140935 (+ strand) : 702 bp

3'UTR

chr12:1140936..1141362 (+ strand) : 427 bp

FASTA

>Os12t0123700-01 class=Sequence position=chr12:1139026..1141362 (+ strand)
AATTAGCTCT CATTAATCAA TTGCTTTGTA GTAATCCATC CATGCACCCA CCTCTCTTTC TCCCGAACAG CAAGAAGATG
AGCCAAGCCC ATGGCGTCTA TAAAAGAGAG CCCTACCCCC TCCATCTCAA AAATTTCAAT CCTTCCTCTT CCTTAGCTTA
TTAGCTTCCT TCCTTCACTA GTGCCAGTTT TCCTCCTACG TAATCTAAGC TAGCCAGGTC GTCATCTTCT TCCTTCAGCT
CACGCTGACC AAACACCATC TGTTATTCTG TTTGTTTGTT TTTTTTTAAA AAAAGAAAAA AAATCTAGCT AGGCGAGCCG
ATTGAAGGAG CTGAGCATGC CGAGCAGCGG CGGCGCCATG CCTGCCcttc caccaggctt ccgcttccac cccaccgacg
aggagctcat cgttcactac ctcatgaacc aggccgcctc catcaagtgc cccgtgccaa tcatcgccga ggtcaacatc
tacaagtgca acccatggga ccttcctggt aactaactaa ctaatcacca tacatatata aactatccat gtatcaatta
aactcgatca aattaatgcc ttcaaactga ccaaatttaa ttttgggctt tgaaaatgga tatggaatgt tgcaggtaag
gcgctgttcg gcgagaacga atggtacttc ttcagcccga gggaccgcaa gtaccccaac ggcgcacgcc ccaaccgcgc
cgccggctcg gggtactgga aggccaccgg caccgacaag tccatcttgt caactccgac gagcgacaac atcggcgtca
agaaggccct agtcttctac aagggcaagc cccccaaggg cgtcaagacc gactggatca tgcacgagta tcgcctcacA
GGCACATCAG CTAACAACAC CACCACCACA AAGCAGCGTA GAGCATCATC CATGACCATG AGGGTGAGAT TCATTTAATT
ACTTAATTTT AGTTCATTAT TAATTTGTTT TTCTCTTCGT CGTACGTCTT CTTTGAAAGC TACGTCGTTG TTTGAATTGG
CATATTGAAG GAAGCAAACG TGCATGTTGC TCTTAGTTAA CTCACTCTAC AAAGTCAAAT TTGTTGATGT TGATTGAGCT
TGTGTTTTAT TCTTTATTTT AAAAATAAAT AAAGCAAGTT TGCACACTTC TAATTATTGT TTACTGCATT TGTGATATTG
TTCATCAGCT GGACGACTGG GTGCTGTGCA GAATCCACAA GAAGAGCAAC GACTTCAATT CCTCTGACCA ACACGACCAA
GAACCCGAGG GATCAACCGT CGATGAACAG CTTGAAGACA TCCATGACAA CAACTCTTCC TCTCAACAAC CTCCTGCTCC
ACCTGACATG AACAACCAAC AGTCAGATTT CCAGCCCATG ACGGCGATGA GCATGAGCAA GTCATGCTCC CTCACCGATC
TCCTCAACAA CCTCGACTGC GCCGCGCTCT CGCAGTTTCT CCTCGACGGC TCATCCGACG CCATCGCTGA GCTTCCTGCT
CCTCCCAGCC CTCTAATATA TCCAAACCAA ACACTAAACT ATAACATCAA CAACAACATG CCACACGCCT TCGAGTCACG
CCTAGATCAT CACGATGGTT ACGTTAACAA TTATAATGTT AATGGCCTAA GGAGGAAGAG AATGATGGCG TGTAGTGCAA
CTTCTTTTGA TGATGGCAGC AGCAGCAGCA GCAGTGACTT TTTGCATGTT GCCAAGAAAC CGCTGCTGCT GCCAAGTGAT
TCAAGGGGCA GTGGTTTTGG AGGAGGTTAC TGCAACCAGC AGCTTTCAGA GACTGCGACT GGTTTTCAGT TTCAGAACGG
CAATATGTTG AGCCATCCAT TTCCTCTGAA CCAGCAGCTA CTGCTGAACA ATCATCTGCA GATGCAGTAG CTAGTAGGCG
TCTAGATCCG TTTACCGATC GATCTGAAGA GAGGTGAATT AATTTCAACG AATGAAACTA CAGATTCAGA GAGGAAGATA
CTGATTGTTC CATTTGGATT TATTTTGAGG AGTTGCATGA CAgatagaca aacagacgga attcttgatg taacccatgc
aaggaaagat tcagatttct tcctatggca ttaatttgtg agtttttttt tgttttcatt ttcatgtaca agaatgtaaa
ttataaatgG TAATATCGTG CAAGCTAGTA CTCAAGCCAA TTTATATGAT AATCTTTATG CATGTTTCTT AATTATTCTG
GTATCAAGCA CACGAAAGAA ACATGCTACT TTGTCGTTGA TTCATTGGAC CTTACAAATT AAACAATTTG TTCTTGTCTG
AATGTGCTGA TATATAA

Locus: Os12g0123700

Loading...

Locus: Os12g0123700

Loading...