Os12t0130200-00

Locus

Os12g0130200

Description

S-Domain receptor like kinase-8, Response to B. glumae and Rice Stripe Virus in resistant genotype CL 161

RAP-DB Gene Symbol Synonym(s)

SDRLK-8

RAP-DB Gene Name Synonym(s)

S-Domain receptor like kinase-8

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK367962 (DDBJ)

Protein Evidence

Q2RAY8 (UniProt)

Literature

PMID: 33777532

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

March 29, 2021

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Biological Process: recognition of pollen (GO:0048544)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Epidermal growth factor-like, type 3 (IPR000742)

S-locus glycoprotein (IPR000858)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

Apple-like (IPR003609)

Protein kinase-like domain (IPR011009)

Protein kinase, ATP binding site (IPR017441)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Expression Databases

TENOR (Os12t0130200-00)

Transcript

2042 bp

>Os12t0130200-00 S-Domain receptor like kinase-8, Response to B. glumae and Rice Stripe Virus  in resistant genotype CL 161
ACACTGGTAACCTTGTCTTGAAAAACTCCAGTGAAAACATTGTTTGGCAAAGTTTCGATT
CACCGACAGACACTTTGCTTCCTACTCAACGCATTCTCGCTACAACAAAGTTAGTCTCTA
CCACTGGGTTACAGGTTCCTGGTCACTATTCCTTCCGTTTCAGCGATCAGTAGATATTGT
CACTTATATATGATGACGCTAATGTTTCCGGTGTATACTGGCCAGATCCTGATTACCTGT
ACTATGAGAATAATAGGAACCTTTATAACAGTACAAGGATAGGTAGTCTTGATGATTATG
GAGAATTTTTTTCGAGTGATCTTGCTAAGCATCAAGCCCGTGTTGCCTCTGATAGAAGTT
TGGGGATTAAAAGGAGGCTTACCTTGGATTATGATGGTAATCTTAGACTCTATAGCTTGA
ATAACTCAGATGGAACATGGACAATTTCATGGATTGCTCAACCTCAAACATGCATGACTC
ATGGTTTGTGTGGTCCATATGGAATCTGCCACTATTCACCTACACCAAGATGTTCATGCC
CACCTGGTTATAAGATGAGGAATCCGGGTAACTGGACACAAGGTTGCAAGCCTATTGTCG
AAATTGCATGCGATGGTAAACAGAATGTAACATTTTTGCAACTTCGAAACACTGATTTTT
GGGGTTCTGATCAACAACATATTGAAAAGGTACCCTGGGAGGTGTGTTGGAACACTTGCA
TAAGTGATTGCACATGTAAGGAATTTCAGTACCAAGAAGGAAATGGTACATGCTATCCAA
AATCTTTTCTCTTTAATGGAAGGACTTTCCCGACACCTTTTGTGCGAACGATGTATATCA
AACTTCCTTCAAGTTTGGATGTTTCTAAAAAACCCATTCCACAGTCTAGTATACATGATT
ATACACCAAGTAGACTTGACTGTGATCGTGTAAACACAATAACCACAGAGGCAGTTCGTA
ACATGAATAAGATTGGTGGGGAGGAACCAAAATGGTTCTACTTCTATGGGTTTATCGGTG
TGTTTTTCATTGTTGAGGTTTTCTTCTTCGCATTTGCATGGTTCCTTGTCTTGAGGAAGG
AGATGTGGTCATCTGAAGTATGGGCAGCTGAGGAAGGCTACAGGGTGATGACTAGTCATT
TTCGAATGTATAGTTATAGAGAGCTGGTTAAGGCAACTGAAAGGTTTAAACATGAGCTTG
GATGGGGAGGTTCAGGAGTCGTCTATAAGGGAATATTGGATGACGATCGAGCAGTGGTCA
TAAAAAAGTTGGAAAATGTCACGCGAAATAGGGAGGAGTTTCAGGATGAGTTGCATGTTA
TTTCAAGAATCAACCATATGAACCTAGTAAGAATTTATTGTTTTTGCTCAGAAAGATTCC
ATAGGTTGCTGGTCTTAGAGTATGTTGAGAATGGATCATTGGCTAATGTACTGTTCAACA
GTAAAATCTTGTTAGATTGGAAGCAAAGGTTTAATATTGCTTTAGGCGTTGCAAAGGGAC
TGGCTTATCTTCACCATGAGTGCCTAGAGTGGGTCATTCACTGCAACCTAAAGCCAGAGA
ACATTTTGCTGGATGAGAACTTAGAACCTAAGATCGCTGACTTTGGGTTGGCAAAGCTGC
TTAGTAGATCTGGCTCTAAGCAGAATGTTTCACGAGCACGAGGGACCATAGGTTACATTG
CTCCAGAATGGATATCTGGTTTACCAATAACAGCAAAGGTTGATGTATATAGTTATGGAG
TCGTTCTTCTTGAGCTAGTGTCAGGAAAACGAGTCTTTGATCTGATCATAGGAGAGGATA
AGACGAAGGTGCATGAGATGCTCAAGAAGTTTATTAAGATGATTTGTTATAGATTGGACA
ATGAGAAATCATTGTGGTTAGCAGAGTTCGTAGATTTCAGAGTGGGTGATGAATTCAACT
ACTTGCAAGCAAAAACTTTGGTAAAGTTGGCTGTGTCCTGCTTGGAAGAAGATAGGAAGA
AAAGGCCAACAATGGAATCAATAGTCGAGAGCCTCCTTTCAGTTGATTTAGCTAGAAGTT
AA

CDS

1869 bp

>Os12t0130200-00 S-Domain receptor like kinase-8, Response to B. glumae and Rice Stripe Virus  in resistant genotype CL 161
ATATTGTCACTTATATATGATGACGCTAATGTTTCCGGTGTATACTGGCCAGATCCTGAT
TACCTGTACTATGAGAATAATAGGAACCTTTATAACAGTACAAGGATAGGTAGTCTTGAT
GATTATGGAGAATTTTTTTCGAGTGATCTTGCTAAGCATCAAGCCCGTGTTGCCTCTGAT
AGAAGTTTGGGGATTAAAAGGAGGCTTACCTTGGATTATGATGGTAATCTTAGACTCTAT
AGCTTGAATAACTCAGATGGAACATGGACAATTTCATGGATTGCTCAACCTCAAACATGC
ATGACTCATGGTTTGTGTGGTCCATATGGAATCTGCCACTATTCACCTACACCAAGATGT
TCATGCCCACCTGGTTATAAGATGAGGAATCCGGGTAACTGGACACAAGGTTGCAAGCCT
ATTGTCGAAATTGCATGCGATGGTAAACAGAATGTAACATTTTTGCAACTTCGAAACACT
GATTTTTGGGGTTCTGATCAACAACATATTGAAAAGGTACCCTGGGAGGTGTGTTGGAAC
ACTTGCATAAGTGATTGCACATGTAAGGAATTTCAGTACCAAGAAGGAAATGGTACATGC
TATCCAAAATCTTTTCTCTTTAATGGAAGGACTTTCCCGACACCTTTTGTGCGAACGATG
TATATCAAACTTCCTTCAAGTTTGGATGTTTCTAAAAAACCCATTCCACAGTCTAGTATA
CATGATTATACACCAAGTAGACTTGACTGTGATCGTGTAAACACAATAACCACAGAGGCA
GTTCGTAACATGAATAAGATTGGTGGGGAGGAACCAAAATGGTTCTACTTCTATGGGTTT
ATCGGTGTGTTTTTCATTGTTGAGGTTTTCTTCTTCGCATTTGCATGGTTCCTTGTCTTG
AGGAAGGAGATGTGGTCATCTGAAGTATGGGCAGCTGAGGAAGGCTACAGGGTGATGACT
AGTCATTTTCGAATGTATAGTTATAGAGAGCTGGTTAAGGCAACTGAAAGGTTTAAACAT
GAGCTTGGATGGGGAGGTTCAGGAGTCGTCTATAAGGGAATATTGGATGACGATCGAGCA
GTGGTCATAAAAAAGTTGGAAAATGTCACGCGAAATAGGGAGGAGTTTCAGGATGAGTTG
CATGTTATTTCAAGAATCAACCATATGAACCTAGTAAGAATTTATTGTTTTTGCTCAGAA
AGATTCCATAGGTTGCTGGTCTTAGAGTATGTTGAGAATGGATCATTGGCTAATGTACTG
TTCAACAGTAAAATCTTGTTAGATTGGAAGCAAAGGTTTAATATTGCTTTAGGCGTTGCA
AAGGGACTGGCTTATCTTCACCATGAGTGCCTAGAGTGGGTCATTCACTGCAACCTAAAG
CCAGAGAACATTTTGCTGGATGAGAACTTAGAACCTAAGATCGCTGACTTTGGGTTGGCA
AAGCTGCTTAGTAGATCTGGCTCTAAGCAGAATGTTTCACGAGCACGAGGGACCATAGGT
TACATTGCTCCAGAATGGATATCTGGTTTACCAATAACAGCAAAGGTTGATGTATATAGT
TATGGAGTCGTTCTTCTTGAGCTAGTGTCAGGAAAACGAGTCTTTGATCTGATCATAGGA
GAGGATAAGACGAAGGTGCATGAGATGCTCAAGAAGTTTATTAAGATGATTTGTTATAGA
TTGGACAATGAGAAATCATTGTGGTTAGCAGAGTTCGTAGATTTCAGAGTGGGTGATGAA
TTCAACTACTTGCAAGCAAAAACTTTGGTAAAGTTGGCTGTGTCCTGCTTGGAAGAAGAT
AGGAAGAAAAGGCCAACAATGGAATCAATAGTCGAGAGCCTCCTTTCAGTTGATTTAGCT
AGAAGTTAA

Protein

622 aa

>Os12t0130200-00 S-Domain receptor like kinase-8, Response to B. glumae and Rice Stripe Virus  in resistant genotype CL 161
ILSLIYDDANVSGVYWPDPDYLYYENNRNLYNSTRIGSLDDYGEFFSSDLAKHQARVASD
RSLGIKRRLTLDYDGNLRLYSLNNSDGTWTISWIAQPQTCMTHGLCGPYGICHYSPTPRC
SCPPGYKMRNPGNWTQGCKPIVEIACDGKQNVTFLQLRNTDFWGSDQQHIEKVPWEVCWN
TCISDCTCKEFQYQEGNGTCYPKSFLFNGRTFPTPFVRTMYIKLPSSLDVSKKPIPQSSI
HDYTPSRLDCDRVNTITTEAVRNMNKIGGEEPKWFYFYGFIGVFFIVEVFFFAFAWFLVL
RKEMWSSEVWAAEEGYRVMTSHFRMYSYRELVKATERFKHELGWGGSGVVYKGILDDDRA
VVIKKLENVTRNREEFQDELHVISRINHMNLVRIYCFCSERFHRLLVLEYVENGSLANVL
FNSKILLDWKQRFNIALGVAKGLAYLHHECLEWVIHCNLKPENILLDENLEPKIADFGLA
KLLSRSGSKQNVSRARGTIGYIAPEWISGLPITAKVDVYSYGVVLLELVSGKRVFDLIIG
EDKTKVHEMLKKFIKMICYRLDNEKSLWLAEFVDFRVGDEFNYLQAKTLVKLAVSCLEED
RKKRPTMESIVESLLSVDLARS*

5'UTR

chr12:1457706..1457878 (+ strand) : 173 bp

CDS

chr12:1457879..1459747 (+ strand) : 1869 bp

FASTA

>Os12t0130200-00 class=Sequence position=chr12:1457706..1459747 (+ strand)
ACACTGGTAA CCTTGTCTTG AAAAACTCCA GTGAAAACAT TGTTTGGCAA AGTTTCGATT CACCGACAGA CACTTTGCTT
CCTACTCAAC GCATTCTCGC TACAACAAAG TTAGTCTCTA CCACTGGGTT ACAGGTTCCT GGTCACTATT CCTTCCGTTT
CAGCGATCAG TAGATATTGT CACTTATATA TGATGACGCT AATGTTTCCG GTGTATACTG GCCAGATCCT GATTACCTGT
ACTATGAGAA TAATAGGAAC CTTTATAACA GTACAAGGAT AGGTAGTCTT GATGATTATG GAGAATTTTT TTCGAGTGAT
CTTGCTAAGC ATCAAGCCCG TGTTGCCTCT GATAGAAGTT TGGGGATTAA AAGGAGGCTT ACCTTGGATT ATGATGGTAA
TCTTAGACTC TATAGCTTGA ATAACTCAGA TGGAACATGG ACAATTTCAT GGATTGCTCA ACCTCAAACA TGCATGACTC
ATGGTTTGTG TGGTCCATAT GGAATCTGCC ACTATTCACC TACACCAAGA TGTTCATGCC CACCTGGTTA TAAGATGAGG
AATCCGGGTA ACTGGACACA AGGTTGCAAG CCTATTGTCG AAATTGCATG CGATGGTAAA CAGAATGTAA CATTTTTGCA
ACTTCGAAAC ACTGATTTTT GGGGTTCTGA TCAACAACAT ATTGAAAAGG TACCCTGGGA GGTGTGTTGG AACACTTGCA
TAAGTGATTG CACATGTAAG GAATTTCAGT ACCAAGAAGG AAATGGTACA TGCTATCCAA AATCTTTTCT CTTTAATGGA
AGGACTTTCC CGACACCTTT TGTGCGAACG ATGTATATCA AACTTCCTTC AAGTTTGGAT GTTTCTAAAA AACCCATTCC
ACAGTCTAGT ATACATGATT ATACACCAAG TAGACTTGAC TGTGATCGTG TAAACACAAT AACCACAGAG GCAGTTCGTA
ACATGAATAA GATTGGTGGG GAGGAACCAA AATGGTTCTA CTTCTATGGG TTTATCGGTG TGTTTTTCAT TGTTGAGGTT
TTCTTCTTCG CATTTGCATG GTTCCTTGTC TTGAGGAAGG AGATGTGGTC ATCTGAAGTA TGGGCAGCTG AGGAAGGCTA
CAGGGTGATG ACTAGTCATT TTCGAATGTA TAGTTATAGA GAGCTGGTTA AGGCAACTGA AAGGTTTAAA CATGAGCTTG
GATGGGGAGG TTCAGGAGTC GTCTATAAGG GAATATTGGA TGACGATCGA GCAGTGGTCA TAAAAAAGTT GGAAAATGTC
ACGCGAAATA GGGAGGAGTT TCAGGATGAG TTGCATGTTA TTTCAAGAAT CAACCATATG AACCTAGTAA GAATTTATTG
TTTTTGCTCA GAAAGATTCC ATAGGTTGCT GGTCTTAGAG TATGTTGAGA ATGGATCATT GGCTAATGTA CTGTTCAACA
GTAAAATCTT GTTAGATTGG AAGCAAAGGT TTAATATTGC TTTAGGCGTT GCAAAGGGAC TGGCTTATCT TCACCATGAG
TGCCTAGAGT GGGTCATTCA CTGCAACCTA AAGCCAGAGA ACATTTTGCT GGATGAGAAC TTAGAACCTA AGATCGCTGA
CTTTGGGTTG GCAAAGCTGC TTAGTAGATC TGGCTCTAAG CAGAATGTTT CACGAGCACG AGGGACCATA GGTTACATTG
CTCCAGAATG GATATCTGGT TTACCAATAA CAGCAAAGGT TGATGTATAT AGTTATGGAG TCGTTCTTCT TGAGCTAGTG
TCAGGAAAAC GAGTCTTTGA TCTGATCATA GGAGAGGATA AGACGAAGGT GCATGAGATG CTCAAGAAGT TTATTAAGAT
GATTTGTTAT AGATTGGACA ATGAGAAATC ATTGTGGTTA GCAGAGTTCG TAGATTTCAG AGTGGGTGAT GAATTCAACT
ACTTGCAAGC AAAAACTTTG GTAAAGTTGG CTGTGTCCTG CTTGGAAGAA GATAGGAAGA AAAGGCCAAC AATGGAATCA
ATAGTCGAGA GCCTCCTTTC AGTTGATTTA GCTAGAAGTT AA

Locus: Os12g0130200

Loading...

Locus: Os12g0130200

Loading...