Os12t0132800-01

Locus

Os12g0132800

Description

Major facilitator superfamily antiporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ZIFL10

CGSNL Gene Name

ZINC-INDUCED FACILITATOR-LIKE 10

Oryzabase Gene Symbol Synonym(s)

OsZIFL10, Os-mfs2, mfs2

Oryzabase Gene Name Synonym(s)

zinc-induced facilitator-like 10, major facilitator superfamily antiporter 2

Transcript Evidence

AK241552 (DDBJ, Best hit)

Protein Evidence

Q8H6D5 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: integral to membrane (GO:0016021)

Functional domain (InterPro)

Major facilitator superfamily (IPR011701)

Major facilitator superfamily domain, general substrate transporter (IPR016196)

Major facilitator superfamily domain (IPR020846)

Full-length cDNA

J065177A21 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0132800-01)

Others

Oryzabase (9479)

KEGG (Os12t0132800-01)

Transcript

1788 bp

>Os12t0132800-01 Major facilitator superfamily antiporter.
tcctcctcCACCTCTTACCTCGTCGTCCTGAGCGCTCCTGGTTGCAGTTGCCTTCTCCTG
ACAACTCCTCTTCGCCTTGGCTAAGTTAGCTAGCTCATCATCACACTCTGCATACGTGCT
TGTCAACTCCATTGAGAGCGTCGCCGTTGATGGCTGAGCCGCCGGCGACCAAGGTGTACC
ACGATGGCTGCCCCGGCTGCGCCATGGAGCAGAGGAAGGAGGAGCACAAGGGCATTCCCT
ACAGGGAGTTCCTCTTCGTTGCCATCACCACCCTCGCCTCCTCTCTGCCAATCTCTTCCT
TGTTCCCCTTCCTGTACTTCATGATAAGAGACTTGCATGTTGCTCGGACAGAGGAAGATA
TTGGATTCTATGCTGGATTTCTTGGCGCATCATATATGATCGGTCGTGGTTTCGCATCGA
TCTTGTGGGGTATGGTGGCAGATCGTATTGGCCGTAAGCCTGTCATTATCTTTTCCATTT
TTGCAGTCATTGTGCTCAATACTTTGTTTGGATTAAGTGTGAAGTACTGGATGGCTGTTA
CCACAAGATTTCTTCTTGGTGCTCTGAATGGATTGCTTGCACCAATAAAGGCGTACTCTA
TCGAAGTTTGCCGAGCTGAACATCAACCTTTGGGCCTATCAATTGTGAGCACAGCATGGG
GGATAGGTCTTGTAGTTGGCCCAGCAACTGGGGGATACCTCGCACAGCCTGTCAAACAAT
ATCCTCATATTTTTCATGAGAAGTCAATATTTGGGAGATTTCCATATCTTCTACCCTGCC
TTTGTATATCACTTTTTGCTCTCTTGGTCCTCCTAAGCTGTATATGGCTACCGGAGACCC
TACATAAGCATAAAGGCCTTGAAGTGGGAGTGGAGACAGCTGAAGCTTCTACTACTCAAG
AAAGTGCAGAATCACATCAGAAAAGCTTATTCAGAAATTGGCCATTGATGTCATCTATTG
TCACATATTGTGTGTTCTCCCTTCATGACACAGCATATAGTGAGatattttctctgtgga
ctgtaagtgatagaaaatatggtggactcagcttttcatctaaagatgttgggcaagttc
ttgcagtggcagGTGCCAGCCTTCTTGTATATCAGCTTTTTATCTACGGTTGGGTTGATA
AAATTCTTGGACCTATCCACTCAACCCGCATTTCAGCGGCACTATCTGTACCAATTATTG
CTGCTTATCCCTTTATGACACACTTATCAGGAATAAGACTTGGTGTTGCCCTCTATAGTG
CAGCAATGATCAAAAGTGTTCTTGCTATAACTATAATTACGGGCACCTCTCTTCTGCAAA
ACAAAGCAGTGCCACAAGGGCAACGGGGTGCTGCAAATGGAATAGCCACAACAGCCATGT
CCTTGTTCAAGGCTATTGCTCCGGCTGGGGCAGGAGTTATATTTTCTTGGGCACAAAAGA
GACAACATGTGGCATTTTTTCCAGGTGACCAGATGGTATTTCTTCTACTGAATCTGACCG
AGGTCATTGGGCTCATGTTAACCTTCAAACCTTTCTTGGCTGTTCCTCAACAATATAAAT
AGAACATTCAGATACTGCTAGCTGGTGTGACAAAGATCATAAAGATGTAGTTACAGTGAG
TAATAAGTATGGCTTGGTATTAAAAGATGGTTTAGATGTGGTTATAGCATAATGGTAGGA
TCATGCAGCATTCCAGTGCAGAGTCTCTGTTGGATTTTGTTCTGCTTTGGGCTTATGAGC
AAGATAACCTTGTATATTGCAGTGTTGAATTTGAATAACTGCTCTTCT

CDS

1413 bp

>Os12t0132800-01 Major facilitator superfamily antiporter.
ATGGCTGAGCCGCCGGCGACCAAGGTGTACCACGATGGCTGCCCCGGCTGCGCCATGGAG
CAGAGGAAGGAGGAGCACAAGGGCATTCCCTACAGGGAGTTCCTCTTCGTTGCCATCACC
ACCCTCGCCTCCTCTCTGCCAATCTCTTCCTTGTTCCCCTTCCTGTACTTCATGATAAGA
GACTTGCATGTTGCTCGGACAGAGGAAGATATTGGATTCTATGCTGGATTTCTTGGCGCA
TCATATATGATCGGTCGTGGTTTCGCATCGATCTTGTGGGGTATGGTGGCAGATCGTATT
GGCCGTAAGCCTGTCATTATCTTTTCCATTTTTGCAGTCATTGTGCTCAATACTTTGTTT
GGATTAAGTGTGAAGTACTGGATGGCTGTTACCACAAGATTTCTTCTTGGTGCTCTGAAT
GGATTGCTTGCACCAATAAAGGCGTACTCTATCGAAGTTTGCCGAGCTGAACATCAACCT
TTGGGCCTATCAATTGTGAGCACAGCATGGGGGATAGGTCTTGTAGTTGGCCCAGCAACT
GGGGGATACCTCGCACAGCCTGTCAAACAATATCCTCATATTTTTCATGAGAAGTCAATA
TTTGGGAGATTTCCATATCTTCTACCCTGCCTTTGTATATCACTTTTTGCTCTCTTGGTC
CTCCTAAGCTGTATATGGCTACCGGAGACCCTACATAAGCATAAAGGCCTTGAAGTGGGA
GTGGAGACAGCTGAAGCTTCTACTACTCAAGAAAGTGCAGAATCACATCAGAAAAGCTTA
TTCAGAAATTGGCCATTGATGTCATCTATTGTCACATATTGTGTGTTCTCCCTTCATGAC
ACAGCATATAGTGAGatattttctctgtggactgtaagtgatagaaaatatggtggactc
agcttttcatctaaagatgttgggcaagttcttgcagtggcagGTGCCAGCCTTCTTGTA
TATCAGCTTTTTATCTACGGTTGGGTTGATAAAATTCTTGGACCTATCCACTCAACCCGC
ATTTCAGCGGCACTATCTGTACCAATTATTGCTGCTTATCCCTTTATGACACACTTATCA
GGAATAAGACTTGGTGTTGCCCTCTATAGTGCAGCAATGATCAAAAGTGTTCTTGCTATA
ACTATAATTACGGGCACCTCTCTTCTGCAAAACAAAGCAGTGCCACAAGGGCAACGGGGT
GCTGCAAATGGAATAGCCACAACAGCCATGTCCTTGTTCAAGGCTATTGCTCCGGCTGGG
GCAGGAGTTATATTTTCTTGGGCACAAAAGAGACAACATGTGGCATTTTTTCCAGGTGAC
CAGATGGTATTTCTTCTACTGAATCTGACCGAGGTCATTGGGCTCATGTTAACCTTCAAA
CCTTTCTTGGCTGTTCCTCAACAATATAAATAG

Protein

470 aa

>Os12t0132800-01 Major facilitator superfamily antiporter.
MAEPPATKVYHDGCPGCAMEQRKEEHKGIPYREFLFVAITTLASSLPISSLFPFLYFMIR
DLHVARTEEDIGFYAGFLGASYMIGRGFASILWGMVADRIGRKPVIIFSIFAVIVLNTLF
GLSVKYWMAVTTRFLLGALNGLLAPIKAYSIEVCRAEHQPLGLSIVSTAWGIGLVVGPAT
GGYLAQPVKQYPHIFHEKSIFGRFPYLLPCLCISLFALLVLLSCIWLPETLHKHKGLEVG
VETAEASTTQESAESHQKSLFRNWPLMSSIVTYCVFSLHDTAYSEIFSLWTVSDRKYGGL
SFSSKDVGQVLAVAGASLLVYQLFIYGWVDKILGPIHSTRISAALSVPIIAAYPFMTHLS
GIRLGVALYSAAMIKSVLAITIITGTSLLQNKAVPQGQRGAANGIATTAMSLFKAIAPAG
AGVIFSWAQKRQHVAFFPGDQMVFLLLNLTEVIGLMLTFKPFLAVPQQYK*

5'UTR

chr12:1588935..1589083 (- strand) : 149 bp

CDS

chr12:1588802..1588934 (- strand) : 133 bp

chr12:1588630..1588670 (- strand) : 41 bp

chr12:1588480..1588540 (- strand) : 61 bp

chr12:1588266..1588368 (- strand) : 103 bp

chr12:1588039..1588141 (- strand) : 103 bp

chr12:1587840..1587893 (- strand) : 54 bp

chr12:1587693..1587755 (- strand) : 63 bp

chr12:1587535..1587584 (- strand) : 50 bp

chr12:1587380..1587455 (- strand) : 76 bp

chr12:1586971..1587141 (- strand) : 171 bp

chr12:1586386..1586473 (- strand) : 88 bp

chr12:1586159..1586244 (- strand) : 86 bp

chr12:1585912..1586019 (- strand) : 108 bp

chr12:1585493..1585537 (- strand) : 45 bp

chr12:1585286..1585374 (- strand) : 89 bp

chr12:1584880..1584923 (- strand) : 44 bp

chr12:1584402..1584499 (- strand) : 98 bp

3'UTR

chr12:1584176..1584401 (- strand) : 226 bp

FASTA

>Os12t0132800-01 class=Sequence position=chr12:1584176..1589083 (- strand)
tcctcctcCA CCTCTTACCT CGTCGTCCTG AGCGCTCCTG GTTGCAGTTG CCTTCTCCTG ACAACTCCTC TTCGCCTTGG
CTAAGTTAGC TAGCTCATCA TCACACTCTG CATACGTGCT TGTCAACTCC ATTGAGAGCG TCGCCGTTGA TGGCTGAGCC
GCCGGCGACC AAGGTGTACC ACGATGGCTG CCCCGGCTGC GCCATGGAGC AGAGGAAGGA GGAGCACAAG GGCATTCCCT
ACAGGGAGTT CCTCTTCGTT GCCATCACCA CCCTCGCCTC CTGTATGAAT TGAACACACA TATACATGCA GAGTCAACTT
AGTTTGATGT TTATCATAAT CTCCTCTTGG TCTTATCTTA TTCTACTGGT TTTTAATTAG TAGCCTTGTC TGTCTCTCCC
CTTAAATTTT CAGCTCTGCC AATCTCTTCC TTGTTCCCCT TCCTGTACTT CATGGTAAGT TTAGTTTCCA TGCATTCCAT
CTAATTTCAT GAAAAATATA TTTTTTACAA AAGGTACTCG ATCCATTCTC TTCTCTAGAG CAGATAAGAG ACTTGCATGT
TGCTCGGACA GAGGAAGATA TTGGATTCTA TGCTGGATTT CTTGGTATAA CATTTCTGAA AAATAATTTG TCACTGAGTA
ACAAATTATT TTGAACACTT CTTCACAACT ACGTCAAAAA TGCAGTAACG TTTACATGAT ATATTTCTGC TGCAGGCGCA
TCATATATGA TCGGTCGTGG TTTCGCATCG ATCTTGTGGG GTATGGTGGC AGATCGTATT GGCCGTAAGC CTGTCATTAT
CTTTTCCATT TTTGCAGTGT AAGCACTATG GTACCTTTCC TAAAATATTG ACAGGAATGT ATCCATGGCA TATGGCATTT
ACTTTGTAGT CTGTTCCATC TGCTAAACAA TTTTTAACCT GTCTTTGAAT CTATACTTCC AGCATTGTGC TCAATACTTT
GTTTGGATTA AGTGTGAAGT ACTGGATGGC TGTTACCACA AGATTTCTTC TTGGTGCTCT GAATGGATTG CTTGCACCAA
TAAAGGTACC TTTTTAGGAG ACATTAAGAT ACTTTGAAAT GTGAAAGAAG TTTGTTGGGG ACAAATGAAG GATGTGGTGT
CAATATCGAT TGGTATTCTT ATTCCATCAA ACATTTACTC AATTATTTTT TCTATTACTT ATGGCTGCAG GCGTACTCTA
TCGAAGTTTG CCGAGCTGAA CATCAACCTT TGGGCCTATC AATTGTAAAT TACAAATCTA TAAATAGCAA ATTGCATCTA
TATATACGAT GTAAGAACTC TGTTTCATCC ATGTCATCTA AATTTTAGGT GAGCACAGCA TGGGGGATAG GTCTTGTAGT
TGGCCCAGCA ACTGGGGGAT ACCTCGCACA GGTAATATTA CATTATATTA TTCGGGTTCA TAGATACATT TTCCTTCTTT
CGTCATTGAT CGATCAAAAT GAATATTTAT ACTTGCCTCT TTCTCTTTCT TACTACCAGC CTGTCAAACA ATATCCTCAT
ATTTTTCATG AGAAGTCAAT ATTTGGGAGG TATTTTCTAT TAAAAACCGG TTCTTCATGT TCAATGAGAT AGTTTGCAAT
TGTGAATGTG TGATCGCAAA TTATGCAGAT TTCCATATCT TCTACCCTGC CTTTGTATAT CACTTTTTGC TCTCTTGGTC
CTCCTAAGCT GTATATGGCT ACCGGTATGT ATTACCTACT ATTTGTTAAG CTGTATTATT AAGATTATAT ATTATATTTC
TATCTGCAAG AATTTTGTTA TGACCTATTT CTAAATAAGT CTGTCATGTT GGATGACAAA AAGAATATCC AAACTAACTG
CATGATCCAT GTGCCTGGTC TACCAACCCT TTTTACCTTG CACATTACTT TATCTCTGTT ATCATTTTTT ATGACTGCAT
ATTTCTTTGG TCAACTAAAC AGGAGACCCT ACATAAGCAT AAAGGCCTTG AAGTGGGAGT GGAGACAGCT GAAGCTTCTA
CTACTCAAGA AAGTGCAGAA TCACATCAGA AAAGCTTATT CAGAAATTGG CCATTGATGT CATCTATTGT CACATATTGT
GTGTTCTCCC TTCATGACAC AGCATATAGT GAGGTAGTTA GTTACAGTTA CTAATGTTCC CCGCAAAAAA AAAAGTTACA
GTTACTAATG TGATAAGAAA TTATTATTAT TATTATTATT ATTATTATTA TTATTATTAT TATTATTATT ATTATTATAT
ATTGACTGCT CAATATCTAT GTAAGAATAT AAATAATTAT GCACACCAAA TATAAAGTCT CTATATCAAA TAGTTGTCAT
GCTTTTCTCA ATAAGGATGG ATATTCATAT TTCTTGCTCC AAAAATAAGC TGAAATGCAT TTGCTGTAAT AACCGTTTCA
TATGTATCCA TGTCAATATT TGTTTTTCTG TTTAATCATA TATCTCTGTA AGTTCCATAA TACCATACCT ATGTATAGCA
GATTAGTTCC ATTTTAGTTT ATAAAGTATT GATCTATTTT ATGATTTTAA ATAAAAGTGT GTAGTCATGA AAGAATCTAT
ATGCTATGTG GAAATGTAAT TTTCTAAACA TTATGTTTTT Ttaacatcag atattttctc tgtggactgt aagtgataga
aaatatggtg gactcagctt ttcatctaaa gatgttgggc aagttcttgc agtggcaggt aaGTCAAATT CAATCAATTT
CTTTCCTGCA AATTTTAAAC ACATTCAATT CCTTAATCAC AGGATCAGGG TGTTTGCATT TAATGTTGAG CTCTAACATC
TTGGTTCGGA AGATAAACAT CTCCTTTGTT ACATTGTAGG TGCCAGCCTT CTTGTATATC AGCTTTTTAT CTACGGTTGG
GTTGATAAAA TTCTTGGACC TATCCACTCA ACCCGCATTT CAGCGGTGAG TTACTAAATT TCAGTATTTC TTATATAATT
TTTACAGTTT ACTTGTTATT GGTAACTGTG AGTTTTAAAA GAAAAGAGTT CAAAATATTG CTGGTTACTA CTTTGCTTTT
ATCAGCTGAC CTTTAGCATT GCAGGCACTA TCTGTACCAA TTATTGCTGC TTATCCCTTT ATGACACACT TATCAGGAAT
AAGACTTGGT GTTGCCCTCT ATAGTGCAGC AATGATCAAA AGTGTTCTTG CTGTAAGTAC TTTATGAACT TAGGATTTTT
TTTAATAAAA AATTATAGAA GTACAAATTC TTAGGTACTT TTTAACAAAC ATTTTGGTTG TGCCACTCAT GGAGGCATGG
AAAACTAATA CTGCAACACC ACGAAAATTT CATAGCAAAG GTAATATTGC ACAATTGTTC AGAGAGACTA TGTGAAAATA
AATACCAATT TTTTAGTTCA AAAGAGAGGT TGAGAAAAAA ATATCCATGA GCTTACAGTT CTGAAATTTA ACCCATATAA
AATTAGTTAG CACTTCACTG CAAATTGCTA GATAATTTAG TTTATTTATT TTTCACATGG CATATTTGAA GATATCAAGA
TACTGATATT TTGTAATGTT GATCAGATAA CTATAATTAC GGGCACCTCT CTTCTGCAAA ACAAAGCAGT GGTACTTGTC
GAACTTATCT CAATCGACTG TTGTCTGATA GGCTCAAAAA GAAAAGAAAT TTCTCTGATA CACTAATATC AAATAAATTT
AATTTTTGAA AATTGCATCG TTTTGACAGC CACAAGGGCA ACGGGGTGCT GCAAATGGAA TAGCCACAAC AGCCATGTCC
TTGTTCAAGG CTATTGCTCC GGCTGGGGCA GGAGTTATGT AAGTACAAAT GTTGCTGTCT ACAACTCCTA GTTATAAACA
AACAACTCAA CAAAGCTACT AGACTCAGTA TCACTTTCCA AGATTGAACA GTAGATTTCT GGCTGACATA ATTGTCAGTT
TGCAATTTGC AGAAAGACTA GAGGGATTTT TTTTTGAACA AACCTACATT TAGATTTTAC CAATTTCAAT GAATAGAGCA
GAAAAAAAAA CTGTAATCAT GAAAATGTTG GTGATTAGTT CGCCCTTCCC AATTTAGTGA ATAGTTGTTG CCTGAAGCCT
AAAGATGAAC ATGTCCTTAC GAAACTGTAA ACCCGTTTGA AGAAAGAAAA GGACTGACTG TTCAAAACCT GTGGTTGCAG
ATTTTCTTGG GCACAAAAGA GACAACATGT GGCATTTTTT CCAGGTAAAT AACTAAATAC TCCAATGAAT TTTTAGGAAC
CATCAACTGT GTGTGACAAC CATTTACTAC AATACTTTAA Attagagcaa gtttaatagt atagccaact agtaaatcca
aattatctac aatcaatttg atagccaatt cataaaatag ttacctacaa gtatatactg cactattaat atttggtccc
acctgtcata cacacaggag tccgtgttgc agcccgcttc tcttctctct ttcctctttt atctcctcca catgtgttta
tagctggttt atagtctgct attgtacctg ctcttaGGTA TGTATAAATC GGTGCTTTGT AATGTTTATT TGATCATATA
AATTGTAAAT TCAACGTTGT GCAGGTGACC AGATGGTATT TCTTCTACTG AATCTGACCG AGGTCATTGG GCTCATGTTA
ACCTTCAAAC CTTTCTTGGC TGTTCCTCAA CAATATAAAT AGAACATTCA GATACTGCTA GCTGGTGTGA CAAAGATCAT
AAAGATGTAG TTACAGTGAG TAATAAGTAT GGCTTGGTAT TAAAAGATGG TTTAGATGTG GTTATAGCAT AATGGTAGGA
TCATGCAGCA TTCCAGTGCA GAGTCTCTGT TGGATTTTGT TCTGCTTTGG GCTTATGAGC AAGATAACCT TGTATATTGC
AGTGTTGAAT TTGAATAACT GCTCTTCT

Locus: Os12g0132800

Loading...

Locus: Os12g0132800

Loading...