Os12t0139400-01

Locus

Os12g0139400

Description

A-type response regulator, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

RR10, OsRR10, Rra2, OsRRA2

RAP-DB Gene Name Synonym(s)

A-TYPE RESPONSE REGULATOR 10, A-TYPE response regulator 10, A-type RR 2

CGSNL Gene Symbol

RR10

CGSNL Gene Name

A-TYPE RESPONSE REGULATOR 10

Oryzabase Gene Symbol Synonym(s)

OsRR10, Rra2, OsRRA2, RR2

Oryzabase Gene Name Synonym(s)

A-TYPE response regulator 10, A-type RR 2

Transcript Evidence

AB249660 (Genbank)

BR000257 (Genbank)

Protein Evidence

Q2QXY3 (UniProt)

Literature

PMID: 16919402

PMID: 16472405

PMID: 17293362

Note

  • Exon-intron structures and exon sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

May 10, 2010

Gene Ontology (GO)

Biological Process: two-component signal transduction system (phosphorelay) (GO:0000160)

Biological Process: regulation of transcription, DNA-dependent (GO:0006355)

Molecular Function: two-component response regulator activity (GO:0000156)

Functional domain (InterPro)

Signal transduction response regulator, receiver domain (IPR001789)

CheY-like superfamily (IPR011006)

Expression Databases

TENOR (Os12t0139400-01)

Others

Oryzabase (8155)

Transcript

930 bp

>Os12t0139400-01 A-type response regulator, Cytokinin signaling
GCTTTTCTTCTTTCTTCATATCTCCAAGAATCCTTTCACATGCTTATGTATATATATAAG
CTCAACCACACCCAAACAACCTTGTAAAGCAAAGCCTTTCATGCCAAGCACACACACCAT
CTGCATCTTCTCTTCTACCATTCTTGCTTTCTCCTTGTAGCCTCTTCCTTCTGTTCTTCC
AGAGAAGAGAAACATATCTGTGCAAGCTTTGCCTTCTTCCATGGCAGTGGCTATAGAGGC
TCCGTTCCATGTCCTGGCTGTGGATGATAGCCTTCCTGACAGGAAGCTCATCGAGAGGCT
ACTCAAGACCTCTTCTTTCCAAGTAACCACTGTTGATTCGGGGAGCAAGGCTCTGGAGTT
CTTGGGGCTCCATGATCATGAGGACAGCCCAATTTCTACTCAATCAGATCAGCAGGAGGT
TGGAGTGAACCTGATCATCACAGACTACTGCATGCCTGGCATGACAGGATATGATCTTCT
CAAGAAGATCAAGGAATCGTCTTATTTAAGGGACATCCCAGTTGTGATCATGTCATCGGA
TAACATTCCTTCAAGGATCAATAGATGCCTGGAGGAAGGAGCTGATGAATTTTTCCTCAA
ACCAGTTCGGCTCTCCGACATGAGCAAGCTGAAGCCCCACATACTGAAAAGCAGATGCAA
GGAGCACTACCAGCAGGAACAACACCTGCAAAGCAACAGCGAAAGCAACAACAGCAGTAA
CCCCACAAGCGAGAACAGCAGCAGCAGCACTAGCACCAACAGCCACAAGAGAAAGGCAGT
CGATGAAGAAATTTTGCCCCACACAATAAGACCAAGGCATAGTTGATTTAGCATCTGACT
GGTCATTTGACACTGATTTTTTTTTCTTGCTTCTGTCTGATCGGTTTTTGACATACTGAT
TTGTAAAAGGGATACTAACATCTAGTTTAC

CDS

606 bp

>Os12t0139400-01 A-type response regulator, Cytokinin signaling
ATGGCAGTGGCTATAGAGGCTCCGTTCCATGTCCTGGCTGTGGATGATAGCCTTCCTGAC
AGGAAGCTCATCGAGAGGCTACTCAAGACCTCTTCTTTCCAAGTAACCACTGTTGATTCG
GGGAGCAAGGCTCTGGAGTTCTTGGGGCTCCATGATCATGAGGACAGCCCAATTTCTACT
CAATCAGATCAGCAGGAGGTTGGAGTGAACCTGATCATCACAGACTACTGCATGCCTGGC
ATGACAGGATATGATCTTCTCAAGAAGATCAAGGAATCGTCTTATTTAAGGGACATCCCA
GTTGTGATCATGTCATCGGATAACATTCCTTCAAGGATCAATAGATGCCTGGAGGAAGGA
GCTGATGAATTTTTCCTCAAACCAGTTCGGCTCTCCGACATGAGCAAGCTGAAGCCCCAC
ATACTGAAAAGCAGATGCAAGGAGCACTACCAGCAGGAACAACACCTGCAAAGCAACAGC
GAAAGCAACAACAGCAGTAACCCCACAAGCGAGAACAGCAGCAGCAGCACTAGCACCAAC
AGCCACAAGAGAAAGGCAGTCGATGAAGAAATTTTGCCCCACACAATAAGACCAAGGCAT
AGTTGA

Protein

202 aa

>Os12t0139400-01 A-type response regulator, Cytokinin signaling
MAVAIEAPFHVLAVDDSLPDRKLIERLLKTSSFQVTTVDSGSKALEFLGLHDHEDSPIST
QSDQQEVGVNLIITDYCMPGMTGYDLLKKIKESSYLRDIPVVIMSSDNIPSRINRCLEEG
ADEFFLKPVRLSDMSKLKPHILKSRCKEHYQQEQHLQSNSESNNSSNPTSENSSSSTSTN
SHKRKAVDEEILPHTIRPRHS*

5'UTR

chr12:1915773..1915992 (+ strand) : 220 bp

CDS

chr12:1915993..1916095 (+ strand) : 103 bp

chr12:1916195..1916286 (+ strand) : 92 bp

chr12:1916384..1916461 (+ strand) : 78 bp

chr12:1916577..1916647 (+ strand) : 71 bp

chr12:1917337..1917598 (+ strand) : 262 bp

3'UTR

chr12:1917599..1917702 (+ strand) : 104 bp

FASTA

>Os12t0139400-01 class=Sequence position=chr12:1915773..1917702 (+ strand)
GCTTTTCTTC TTTCTTCATA TCTCCAAGAA TCCTTTCACA TGCTTATGTA TATATATAAG CTCAACCACA CCCAAACAAC
CTTGTAAAGC AAAGCCTTTC ATGCCAAGCA CACACACCAT CTGCATCTTC TCTTCTACCA TTCTTGCTTT CTCCTTGTAG
CCTCTTCCTT CTGTTCTTCC AGAGAAGAGA AACATATCTG TGCAAGCTTT GCCTTCTTCC ATGGCAGTGG CTATAGAGGC
TCCGTTCCAT GTCCTGGCTG TGGATGATAG CCTTCCTGAC AGGAAGCTCA TCGAGAGGCT ACTCAAGACC TCTTCTTTCC
AAGGTATTAC AAGATTTTTC TTTTGTGCTT GCAGACTCTT TTCTTCTCTC AGTTGCTGTA TGAATTGGCA CCTGATGGTA
GGTTTGGCTT TTGTTTGTGT AGTAACCACT GTTGATTCGG GGAGCAAGGC TCTGGAGTTC TTGGGGCTCC ATGATCATGA
GGACAGCCCA ATTTCTACTC AATCAGATCA GCAGGTAAGA AGATGAATGG TACCATAGGT GCTAACCATG AAAAAAAATT
GTGTTTTGTT CTGAACAAGA GTTTCTAAAT TGCTCTTTTA TGGATAAACA GGAGGTTGGA GTGAACCTGA TCATCACAGA
CTACTGCATG CCTGGCATGA CAGGATATGA TCTTCTCAAG AAGATCAAGG TAATTACCAT CTCTGCTCTA TTTGATTGTA
CCAACCATTT GATTTGATCT ACTCAAGATG ACAGTGAGGT CAGTTCCTGA ATACAGTTTT TTCCCTTTTG GTTTGTTCAA
TCAGGAATCG TCTTATTTAA GGGACATCCC AGTTGTGATC ATGTCATCGG ATAACATTCC TTCAAGGATC AATAGGTGAA
CACTCTTATG GATCTACCAT ATTATTTCGA CCATCTATTA CAATACAAGC ATCTTATGAT ATTTGGATGA ACATGCCAAA
GTCAGATGTG CAGATAATTT AGTAAAAACA TAGAGCACAA AAAAGGAGAA CATCTTTGTA TGCATATAGA GAAAAAAGGT
AGTGGAAACC TTATCATTTG TGAAAAATAA TCAAATATAG AACCAAGCTG GTTTAAGGCT AAACTTGATA TGGAGATCTC
TCCGAATCCT TAATTGATTT GGAGTCACAT GTAGTATAAT TAAGGAACAA GCCCCACAGC TCACGTCGTC TTAATATTCT
ATCTCGACAG TTTTGGTGTA AAATCAATAA TGAAGATATG GAGTGATACG CAAATCAATC TTGTCGATCT TCCATGATGT
GGTGTCTAAT AAAATGGTCT TTAGTTGCAG ACAACTAACT AGCACCACAT GTCTTTGTCA CAATATATTC TATTATACAT
GCACAACAAA TGGAGCAACA AGAGGGCACT CTAAAAGTAA AGTAAAAAAA AATCCTCCAG ATATCATAAG ATATGAATAA
AAAAAGAAAT TTGTAATGGA TAGTACATGG AGAATAATTC TGTGTTCAAT TTCTGGATTG CATATCATGG TTTTTGATCT
TAGAATAAAC TCTGATACAG TTATGATTTT GTTATCTGAA TCAGATGCCT GGAGGAAGGA GCTGATGAAT TTTTCCTCAA
ACCAGTTCGG CTCTCCGACA TGAGCAAGCT GAAGCCCCAC ATACTGAAAA GCAGATGCAA GGAGCACTAC CAGCAGGAAC
AACACCTGCA AAGCAACAGC GAAAGCAACA ACAGCAGTAA CCCCACAAGC GAGAACAGCA GCAGCAGCAC TAGCACCAAC
AGCCACAAGA GAAAGGCAGT CGATGAAGAA ATTTTGCCCC ACACAATAAG ACCAAGGCAT AGTTGATTTA GCATCTGACT
GGTCATTTGA CACTGATTTT TTTTTCTTGC TTCTGTCTGA TCGGTTTTTG ACATACTGAT TTGTAAAAGG GATACTAACA
TCTAGTTTAC 

Locus: Os12g0139400

Loading...

Locus: Os12g0139400

Loading...