Os12t0147800-01

Locus

Os12g0147800

Description

Phytosulphokine precursor, osa-miR164c target gene, Regulation of seed vigor

RAP-DB Gene Symbol Synonym(s)

OsPSK5, PSK5

RAP-DB Gene Name Synonym(s)

phytosulfokine 5

CGSNL Gene Symbol

PSK3

CGSNL Gene Name

PHYTOSULFOKINE 3

Oryzabase Gene Symbol Synonym(s)

OsPSK3, GREP2, OMT9, OsPSK5, PSK5

Oryzabase Gene Name Synonym(s)

phytosulfokine 3, Oryza miR164-targeted gene 9

Transcript Evidence

AK059860

AK101186

Protein Evidence

O81277

Literature

PMID: 30791202

Note

Manual Curation

September 20, 2019

Gene Ontology (GO)

Biological Process: cell population proliferation (GO:0008283)

Molecular Function: growth factor activity (GO:0008083)

Cellular Component: extracellular region (GO:0005576)

Functional domain (InterPro)

Phytosulfokine (IPR009438)

Full-length cDNA

006-207-C02 (Online Clone Ordering)

J033030B21 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0147800-01)

Others

Oryzabase (14419)

Transcript

984 bp

>Os12t0147800-01 Phytosulphokine precursor, osa-miR164c target gene, Regulation of seed vigor
ACACTCTTCAGTCTCACACAAACCCAAAAACCCAAAGCTTAGCCAAGCTACTAGCTAGCT
CCTCACTTCTTCCAGCTTCTTACACTAATACAGCTCGAGCCACTTCGTCTTCTCCTCTCT
TGCAGCATAGTTTAAGTTTGAGATAGGATTGGCGATAGATATGAGGCCGACTGGTCGTCG
TTCTTCTCCGCCGGTGGCTGCTGCTCTTGCCCTGCTTCTCCTCCTCGTCCTCTTCTTCTT
CTCCCACTGCGCCTCAGCTGCTCGCCCACTGCCAGCATCAGCAGCAGCAGAGCTAGTGCT
TCAGGATGGCGCCACCGGCAATGGCGACGAGGTTTCCGAGTTGATGGGAGCAGCTGAGGA
GGAAGCAGCAGGATTATGCGAGGAGGGGAACGAGGAGTGCGTGGAGAGGAGGATGCTTCG
CGACGCCCACCTCGACTACATCTACACGCAGAAGAGGAACAGGCCTTGAAATCTTGAATC
ATAATCTCCAAGTCGATACAAGGAGGAATTAATCAGTAGTAAACCTACATAAATTAATCT
ACTATCTGCAGCCTGTTTTCAACTGCATGTATCAGTGTATTAGTCGATCTAGGATAATAT
TTTGCATGTGTACTCAAGTAAACTGTCGTCTGTATAACCCCGTTATGTACATGGTTGTAT
TTCTTTCTCCAAAGTGTTATCGAACTCTCTGTTGATCTCTGATACATCTGTATGTGTAGC
ATCAGAGAAAAGATCGAGCACTTGTGGGTTATGATCTGACGATCGAGTGTATGAACAGTG
CTAATGGTGTAGTAAGTTTTTGCTTAATTGTCTTGGACTTCTCATGGTGTGAAATGTTCG
AACAAGCAGAACATATTCCCTATATCTTCCTTGGTAGCTGGTGCTTGGTACTACTACCAG
CACAAATGTTACCAGTATGCATGTTTCATAAAGAGAAGGTATAATGGATTATAAATATAT
AAACTTGCATTTGTTTTCTGCCGC

CDS

309 bp

>Os12t0147800-01 Phytosulphokine precursor, osa-miR164c target gene, Regulation of seed vigor
ATGAGGCCGACTGGTCGTCGTTCTTCTCCGCCGGTGGCTGCTGCTCTTGCCCTGCTTCTC
CTCCTCGTCCTCTTCTTCTTCTCCCACTGCGCCTCAGCTGCTCGCCCACTGCCAGCATCA
GCAGCAGCAGAGCTAGTGCTTCAGGATGGCGCCACCGGCAATGGCGACGAGGTTTCCGAG
TTGATGGGAGCAGCTGAGGAGGAAGCAGCAGGATTATGCGAGGAGGGGAACGAGGAGTGC
GTGGAGAGGAGGATGCTTCGCGACGCCCACCTCGACTACATCTACACGCAGAAGAGGAAC
AGGCCTTGA

Protein

103 aa

>Os12t0147800-01 Phytosulphokine precursor, osa-miR164c target gene, Regulation of seed vigor
MRPTGRRSSPPVAAALALLLLLVLFFFSHCASAARPLPASAAAELVLQDGATGNGDEVSE
LMGAAEEEAAGLCEEGNEECVERRMLRDAHLDYIYTQKRNRP*

5'UTR

chr12:2338072..2338231 (+ strand) : 160 bp

CDS

chr12:2338232..2338411 (+ strand) : 180 bp

chr12:2338527..2338655 (+ strand) : 129 bp

3'UTR

chr12:2338656..2339170 (+ strand) : 515 bp

FASTA

>Os12t0147800-01 class=Sequence position=chr12:2338072..2339170 (+ strand)
ACACTCTTCA GTCTCACACA AACCCAAAAA CCCAAAGCTT AGCCAAGCTA CTAGCTAGCT CCTCACTTCT TCCAGCTTCT
TACACTAATA CAGCTCGAGC CACTTCGTCT TCTCCTCTCT TGCAGCATAG TTTAAGTTTG AGATAGGATT GGCGATAGAT
ATGAGGCCGA CTGGTCGTCG TTCTTCTCCG CCGGTGGCTG CTGCTCTTGC CCTGCTTCTC CTCCTCGTCC TCTTCTTCTT
CTCCCACTGC GCCTCAGCTG CTCGCCCACT GCCAGCATCA GCAGCAGCAG AGCTAGTGCT TCAGGATGGC GCCACCGGCA
ATGGCGACGA GGTTTCCGAG GTGAGAATTA ATCGAACACC ACACAGTAGC TGATTATACA AGAATTGATC GAAGAAGCAA
CTAGTGGTAG CTTGCTAAGC TTGATGTGTG TTTTGTCTGT CTTGTTCTTG GTCAGTTGAT GGGAGCAGCT GAGGAGGAAG
CAGCAGGATT ATGCGAGGAG GGGAACGAGG AGTGCGTGGA GAGGAGGATG CTTCGCGACG CCCACCTCGA CTACATCTAC
ACGCAGAAGA GGAACAGGCC TTGAAATCTT GAATCATAAT CTCCAAGTCG ATACAAGGAG GAATTAATCA GTAGTAAACC
TACATAAATT AATCTACTAT CTGCAGCCTG TTTTCAACTG CATGTATCAG TGTATTAGTC GATCTAGGAT AATATTTTGC
ATGTGTACTC AAGTAAACTG TCGTCTGTAT AACCCCGTTA TGTACATGGT TGTATTTCTT TCTCCAAAGT GTTATCGAAC
TCTCTGTTGA TCTCTGATAC ATCTGTATGT GTAGCATCAG AGAAAAGATC GAGCACTTGT GGGTTATGAT CTGACGATCG
AGTGTATGAA CAGTGCTAAT GGTGTAGTAA GTTTTTGCTT AATTGTCTTG GACTTCTCAT GGTGTGAAAT GTTCGAACAA
GCAGAACATA TTCCCTATAT CTTCCTTGGT AGCTGGTGCT TGGTACTACT ACCAGCACAA ATGTTACCAG TATGCATGTT
TCATAAAGAG AAGGTATAAT GGATTATAAA TATATAAACT TGCATTTGTT TTCTGCCGC

Locus: Os12g0147800

Loading...

Locus: Os12g0147800

Loading...