Os12t0154800-01

Locus

Os12g0154800

Description

Germin-like protein 12-2, Disease resistance

RAP-DB Gene Symbol Synonym(s)

GLP12-2, OsGLP12-2

RAP-DB Gene Name Synonym(s)

GERMIN-LIKE PROTEIN 12-2, Germin-like protein 12-2

CGSNL Gene Symbol

GLP12-2

CGSNL Gene Name

GERMIN-LIKE PROTEIN 12-2

Oryzabase Gene Symbol Synonym(s)

OsGLP12-2

Oryzabase Gene Name Synonym(s)

Germin-like protein 12-2

Transcript Evidence

Inferred from literature

Protein Evidence

Q2QXJ2 (UniProt)

Literature

PMID: 19011003

Note

Manual Curation

May 25, 2009

Gene Ontology (GO)

Cellular Component: apoplast (GO:0048046)

Molecular Function: manganese ion binding (GO:0030145)

Molecular Function: nutrient reservoir activity (GO:0045735)

Functional domain (InterPro)

Germin (IPR001929)

Cupin 1 (IPR006045)

Cupin, RmlC-type (IPR011051)

Germin, manganese binding site (IPR019780)

Expression Databases

TENOR (Os12t0154800-00)

Others

Oryzabase (8235)

Transcript

690 bp

>Os12t0154800-01 Germin-like protein 12-2, Disease resistance
ATGGCCTCCTCGAACTTCTTTCTTCTCACAGCTCTCATCGCTTTGGTCGCTACTCAGGCC
ATGGCTTCTGATCCCAGTCCTCTTCAGGACTTCTGCGTTGCCGACAGGAACTCTCCAGTA
CATGTCAATGGGTTCCCTTGCAAGGATGCTAAAGATGTGAATGTTGATGACTTCTTCCTA
GCAGCTAACCTCGACAAGCCGATGGACACAACCAAGAGCAAGGCTGGATCCAATGTTACA
TTGATCAATGTGATGAAACTCGCAGGTCTCAACACCCTTGGCATCTCCATGGCAAGGATC
GACTATGCTCCTAAAGGGCAAAACCCACCACACACGCATCCCCGTGCTACCGAGATCCTA
ACTGTTCTTGAGGGTACACTCTATGTTGGTTTTGTTACATCGAACCAAGCAAACGGAGAA
AACAAGCTCTTCACCAAGACACTTAACAAGGGTGATGTCTTCGTGTTCCCACAAGGTCTC
ATTCACTTCCAGTTCAATCCAAGCTATGATAAGCCAGCAGTTGCCATCGCTGCACTTAGC
AGCCAGAACCCTGGAGCGATTACCATTGCTAATGCAGTATTTGGATCAAATTCACCAATC
TCGGATGACGTTCTTGCTAAGGCATTTCAGGTGGACAAGAAAGCTGTGGATTGGCTCCAA
GCTCAGTTCTGGGAGAACAACCATAACTAA

CDS

690 bp

>Os12t0154800-01 Germin-like protein 12-2, Disease resistance
ATGGCCTCCTCGAACTTCTTTCTTCTCACAGCTCTCATCGCTTTGGTCGCTACTCAGGCC
ATGGCTTCTGATCCCAGTCCTCTTCAGGACTTCTGCGTTGCCGACAGGAACTCTCCAGTA
CATGTCAATGGGTTCCCTTGCAAGGATGCTAAAGATGTGAATGTTGATGACTTCTTCCTA
GCAGCTAACCTCGACAAGCCGATGGACACAACCAAGAGCAAGGCTGGATCCAATGTTACA
TTGATCAATGTGATGAAACTCGCAGGTCTCAACACCCTTGGCATCTCCATGGCAAGGATC
GACTATGCTCCTAAAGGGCAAAACCCACCACACACGCATCCCCGTGCTACCGAGATCCTA
ACTGTTCTTGAGGGTACACTCTATGTTGGTTTTGTTACATCGAACCAAGCAAACGGAGAA
AACAAGCTCTTCACCAAGACACTTAACAAGGGTGATGTCTTCGTGTTCCCACAAGGTCTC
ATTCACTTCCAGTTCAATCCAAGCTATGATAAGCCAGCAGTTGCCATCGCTGCACTTAGC
AGCCAGAACCCTGGAGCGATTACCATTGCTAATGCAGTATTTGGATCAAATTCACCAATC
TCGGATGACGTTCTTGCTAAGGCATTTCAGGTGGACAAGAAAGCTGTGGATTGGCTCCAA
GCTCAGTTCTGGGAGAACAACCATAACTAA

Protein

230 aa

>Os12t0154800-01 Germin-like protein 12-2, Disease resistance
MASSNFFLLTALIALVATQAMASDPSPLQDFCVADRNSPVHVNGFPCKDAKDVNVDDFFL
AANLDKPMDTTKSKAGSNVTLINVMKLAGLNTLGISMARIDYAPKGQNPPHTHPRATEIL
TVLEGTLYVGFVTSNQANGENKLFTKTLNKGDVFVFPQGLIHFQFNPSYDKPAVAIAALS
SQNPGAITIANAVFGSNSPISDDVLAKAFQVDKKAVDWLQAQFWENNHN*

CDS

chr12:2693326..2693443 (- strand) : 118 bp

chr12:2692634..2693205 (- strand) : 572 bp

FASTA

>Os12t0154800-01 class=Sequence position=chr12:2692634..2693443 (- strand)
ATGGCCTCCT CGAACTTCTT TCTTCTCACA GCTCTCATCG CTTTGGTCGC TACTCAGGCC ATGGCTTCTG ATCCCAGTCC
TCTTCAGGAC TTCTGCGTTG CCGACAGGAA CTCTCCAGGT AGTGTACTTC TTCACTGATC ATGCAGTTAC ATCAGATTAA
CAATGATATG AGATATTCAT GTTGTACATA TATATGTTTC TAGCTTTCGA TCTGACCTTT GTATGTTCTT CAATGTAGTA
CATGTCAATG GGTTCCCTTG CAAGGATGCT AAAGATGTGA ATGTTGATGA CTTCTTCCTA GCAGCTAACC TCGACAAGCC
GATGGACACA ACCAAGAGCA AGGCTGGATC CAATGTTACA TTGATCAATG TGATGAAACT CGCAGGTCTC AACACCCTTG
GCATCTCCAT GGCAAGGATC GACTATGCTC CTAAAGGGCA AAACCCACCA CACACGCATC CCCGTGCTAC CGAGATCCTA
ACTGTTCTTG AGGGTACACT CTATGTTGGT TTTGTTACAT CGAACCAAGC AAACGGAGAA AACAAGCTCT TCACCAAGAC
ACTTAACAAG GGTGATGTCT TCGTGTTCCC ACAAGGTCTC ATTCACTTCC AGTTCAATCC AAGCTATGAT AAGCCAGCAG
TTGCCATCGC TGCACTTAGC AGCCAGAACC CTGGAGCGAT TACCATTGCT AATGCAGTAT TTGGATCAAA TTCACCAATC
TCGGATGACG TTCTTGCTAA GGCATTTCAG GTGGACAAGA AAGCTGTGGA TTGGCTCCAA GCTCAGTTCT GGGAGAACAA
CCATAACTAA 

Locus: Os12g0154800

Loading...

Locus: Os12g0154800

Loading...