Os12t0163000-00

Locus

Os12g0163000

Description

Similar to CNGC18 (CYCLIC NUCLEOTIDE-GATED CHANNEL 18); calmodulin binding / cyclic nucleotide binding / ion channel.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CNGC16

CGSNL Gene Name

CYCLIC NUCLEOTIDE GATED CHANNEL 16

Oryzabase Gene Symbol Synonym(s)

OsCNGC16, OsCNGC8, OsSTA273

Oryzabase Gene Name Synonym(s)

Cyclic nucleotide gated channel 16, Cyclic nucleotide-gated ion channel 8

Transcript Evidence

ab initio prediction

Protein Evidence

NP_196991.1 (RefSeq)

Literature

Note

  • Exon-intron structures, exon and CDS sequences are different between Build 5 and IRGSP-1.0.

Manual Curation

Functional domain (InterPro)

Cyclic nucleotide-binding domain (IPR000595)

RmlC-like jelly roll fold (IPR014710)

Cyclic nucleotide-binding-like (IPR018490)

Expression Databases

TENOR (Os12t0163000-00)

Others

Oryzabase (15489)

Transcript

681 bp

>Os12t0163000-00 Similar to CNGC18 (CYCLIC NUCLEOTIDE-GATED CHANNEL 18); calmodulin binding / cyclic nucleotide binding / ion channel.
ATGCTGTTCGTCATCCGCGGCGAGCTCGAGAGCTCCACCACCGACGGCGGCCGGACCAAC
TTCTTTAGCTCCATCACCCTCCGCCCCGGCGACTTCTGCGGCGAGGAGCTCCTCACCTGG
GCGCTCATGCCCAACCCCAGCCTCAACTTCCCGCAGTCGACGAGGACGGTGAGGTCGGTC
ACCGAGGTGGAGGCGTTCGCGCTCCGCGCCGAGGACCTCAAGTACGTCGCCAACCAGTTC
AAGCGGCTGCACAGCAAGCGGCTGCAGCACGCGTTCCGGTACTACTCCCACCAATGGCGG
AGCTGGGGCGCGTGCTTCGTGCAGGGCGCGTGGCGCCGCTACAAGAAGCGCAAGCTCGCC
AGGGAGCTCAGCAAGCAGGAGGAGCTCTACTACATGCAGGGCCAGGGCGGCGACGACGGC
GACGGGCACGACGACAGCGACAGCGCGCCGCTGCTCGGTGCCGGCGTCGGCGCCGGCGGA
GACCACAGGGACGGCGCCGCCGCCGGCGCGGCGCACCTCGGCGCGACGTTCCTGGCGTCC
AAGTTCGCCAAGAACACCAAGAAGAGCGCCGCGGCGCACCACGGCAAGGCGAGGATGGAG
GACGTGTCCAGCATCAAGTTCCCCAAGCTGGCCAAGCCCGACGAGCCCGACTTCTCCCTC
AGCTCCGACGACGTGCTGTGA

CDS

681 bp

>Os12t0163000-00 Similar to CNGC18 (CYCLIC NUCLEOTIDE-GATED CHANNEL 18); calmodulin binding / cyclic nucleotide binding / ion channel.
ATGCTGTTCGTCATCCGCGGCGAGCTCGAGAGCTCCACCACCGACGGCGGCCGGACCAAC
TTCTTTAGCTCCATCACCCTCCGCCCCGGCGACTTCTGCGGCGAGGAGCTCCTCACCTGG
GCGCTCATGCCCAACCCCAGCCTCAACTTCCCGCAGTCGACGAGGACGGTGAGGTCGGTC
ACCGAGGTGGAGGCGTTCGCGCTCCGCGCCGAGGACCTCAAGTACGTCGCCAACCAGTTC
AAGCGGCTGCACAGCAAGCGGCTGCAGCACGCGTTCCGGTACTACTCCCACCAATGGCGG
AGCTGGGGCGCGTGCTTCGTGCAGGGCGCGTGGCGCCGCTACAAGAAGCGCAAGCTCGCC
AGGGAGCTCAGCAAGCAGGAGGAGCTCTACTACATGCAGGGCCAGGGCGGCGACGACGGC
GACGGGCACGACGACAGCGACAGCGCGCCGCTGCTCGGTGCCGGCGTCGGCGCCGGCGGA
GACCACAGGGACGGCGCCGCCGCCGGCGCGGCGCACCTCGGCGCGACGTTCCTGGCGTCC
AAGTTCGCCAAGAACACCAAGAAGAGCGCCGCGGCGCACCACGGCAAGGCGAGGATGGAG
GACGTGTCCAGCATCAAGTTCCCCAAGCTGGCCAAGCCCGACGAGCCCGACTTCTCCCTC
AGCTCCGACGACGTGCTGTGA

Protein

227 aa

>Os12t0163000-00 Similar to CNGC18 (CYCLIC NUCLEOTIDE-GATED CHANNEL 18); calmodulin binding / cyclic nucleotide binding / ion channel.
MLFVIRGELESSTTDGGRTNFFSSITLRPGDFCGEELLTWALMPNPSLNFPQSTRTVRSV
TEVEAFALRAEDLKYVANQFKRLHSKRLQHAFRYYSHQWRSWGACFVQGAWRRYKKRKLA
RELSKQEELYYMQGQGGDDGDGHDDSDSAPLLGAGVGAGGDHRDGAAAGAAHLGATFLAS
KFAKNTKKSAAAHHGKARMEDVSSIKFPKLAKPDEPDFSLSSDDVL*

CDS

chr12:3186847..3187527 (- strand) : 681 bp

FASTA

>Os12t0163000-00 class=Sequence position=chr12:3186847..3187527 (- strand)
ATGCTGTTCG TCATCCGCGG CGAGCTCGAG AGCTCCACCA CCGACGGCGG CCGGACCAAC TTCTTTAGCT CCATCACCCT
CCGCCCCGGC GACTTCTGCG GCGAGGAGCT CCTCACCTGG GCGCTCATGC CCAACCCCAG CCTCAACTTC CCGCAGTCGA
CGAGGACGGT GAGGTCGGTC ACCGAGGTGG AGGCGTTCGC GCTCCGCGCC GAGGACCTCA AGTACGTCGC CAACCAGTTC
AAGCGGCTGC ACAGCAAGCG GCTGCAGCAC GCGTTCCGGT ACTACTCCCA CCAATGGCGG AGCTGGGGCG CGTGCTTCGT
GCAGGGCGCG TGGCGCCGCT ACAAGAAGCG CAAGCTCGCC AGGGAGCTCA GCAAGCAGGA GGAGCTCTAC TACATGCAGG
GCCAGGGCGG CGACGACGGC GACGGGCACG ACGACAGCGA CAGCGCGCCG CTGCTCGGTG CCGGCGTCGG CGCCGGCGGA
GACCACAGGG ACGGCGCCGC CGCCGGCGCG GCGCACCTCG GCGCGACGTT CCTGGCGTCC AAGTTCGCCA AGAACACCAA
GAAGAGCGCC GCGGCGCACC ACGGCAAGGC GAGGATGGAG GACGTGTCCA GCATCAAGTT CCCCAAGCTG GCCAAGCCCG
ACGAGCCCGA CTTCTCCCTC AGCTCCGACG ACGTGCTGTG A