Os12t0163600-01

Locus

Os12g0163600

Description

Pentatricopeptide repeat protein, Organellar RNA editing

RAP-DB Gene Symbol Synonym(s)

OsPGL1

RAP-DB Gene Name Synonym(s)

Pale Green Leaves 1

CGSNL Gene Symbol

PGL1

CGSNL Gene Name

PALE GREEN LEAVES 1

Oryzabase Gene Symbol Synonym(s)

OsPGL1

Oryzabase Gene Name Synonym(s)

Pale Green Leaves 1

Transcript Evidence

AK067553

Protein Evidence

Q2QXB0

Literature

PMID: 29562289

Note

Manual Curation

March 20, 2019

Gene Ontology (GO)

Molecular Function: protein binding (GO:0005515)

Molecular Function: zinc ion binding (GO:0008270)

Functional domain (InterPro)

Tetratricopeptide-like helical domain superfamily (IPR011990)

DYW domain (IPR032867)

Pentatricopeptide repeat (IPR002885)

Experimentally confirmed subcellular location

chloroplast (GO:0009507)

mitochondrion (GO:0005739)

Full-length cDNA

J013108L03 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0163600-01)

RiceXPro (AK067553)

Others

Oryzabase (22393)

KEGG (Os12t0163600-01)

Transcript

2626 bp

>Os12t0163600-01 Pentatricopeptide repeat protein, Organellar RNA editing
GAAATGAAACGATCTGGTTGCCTTCTCCGGTTCTCCCCAAGCAAACACGGACTAGGGCCT
GCGCCGCGGCGGCGGCGGCGGCGGCGCTGCTTTTCCCCGGCGCGCCCCGTCCCCGGCAGC
GGCTCCTCCGGCGTGGTACCTCCCAAGCGCTTCCGATCCTCGACATGACACTGGCACCAA
CCGGTCTCCATGACGGCGACATCCAACGCCGCCGCCGGCGCGGCCACGCTGATGCCGCTG
CTGATCCACCTCCTTCGCGGCGCCTCCGACCTCGCCTCCGTGTCCGCCACCCACGCCAAG
CTCCTCAAGCTCGGGGCGGCCTCCTCGGTCGCCTCCTCCAACCACCTCCTCGCGGCGTAC
GGCCGCTGCGGCTGCACCGCCCTCGCGCGCCACCTGTTCGACGGAATGCGCGACCGGAAC
GTCGTCTCCTGGACGGCCCTCATGTCCGGGTACGCCAGCGCCGGCCGGCCCCGGGCGGCC
GTCGCCCTCCTCCGCGCCATGGCACGCAGCGGCGTGCCACCCAACGCCTTCACCTTCTCT
ACAGCTGCCAGCTCGTGCGCGCGCCTGGCTGACGCCGGCCTTGGGCGGCAggtgcatgcc
cgcgctgaggtcgcggggtacgcgtgcgacagcgtcgtttccactgcgctcGTCGACATG
TACGGCAAGGCCGGCAGGGTCGGGGACGCCCGCGCTGTGTTCGACGCAATGCCCGTGACG
GCGAGAAACGCGGTTTCCTGGGCCTCGATGCTGTCGGTGTATGCGCAGAACGCGCTCGGG
CATGACGCTATCCAGCTCTTCGCCGAGCTCAGAACCAATGGCGAAGACATGGCGCCCAAC
CACTTCATGCTGTCAAGCGTGGTGAACGCGTGCGCGGGCGTCGGGCGGCTTGGCATCGGC
AAGTGCATTCACGGCATGGTCCTCCACCATGGGCACGAAGACAATGACGTGGTTGCAGTG
GCTCTGGTTGACATGTACTCCAAATGTGGCATCTACGAGTACTCAAAGAAGGTGTTCGAC
AGGATCAACCAGCCGTCGGTCATCCCCTACACCTCCATCATCGTGGCGACGGCGAAGTAC
GGCCTCGGCAGGTGCGCACTCGCTTTGTTCAGTGACATGGTTGGCCGAGGCGTGCAGCCA
AACAGTGTCACACTGCTCGGCGTCCTGCACGCTTGCAGCCACTCAGGTCTGGTCGACACC
GGCCTCCAGCTCCTCCGTTCAATGCGAAGCGAGTACGGCATTGATCCATGTGCCAGCCAC
TACACTTGTGCTGTCGACATGCTCGGTCGTGCAGGTCAGCTCGAGGCGGCATTCGAGCTG
GCCGACGAAGCACAGGTCAATGGCAATGACGCCCTCATGCTGTGGAGCTCATTGCTGTCA
GCTTGCCGGAACCACAAGCGCCTGGACCTAGCAACCATGGCTGGGCAGAAGGTATCAGAG
TTCACCCAAGATGTGGCCGGCGCACTGGTGGTCATGTCGAACGCATACGCTTCAGCCGGT
CAAGCCGACGACGCTGCTGCGGTGTGGTCGAACATGAGGCGGCGCGGCATTCGGAAGGAT
CCCGGGTGCAGCTGGATCGAGATAAAGGACATCTCCTACGTGTTCTACGCTGGCATGGTA
TCGCCTGCCGGCTCAAGGGCCGGTGAGGTGATGCTGCTGTTAGATGAATTGGAGGGCAAG
ATGAGGGAGAAGGGTTACAAGGGGAGAATTGGCAGTGCCAGAGTCCTTGATGCTGATGAA
GAAGAGGATGGAAATCATCATCATCAGGAAGGCAGAGGTGTGATGGTTGGAGTGCACAGT
GAGTTGCTGGCATTGGGGCTTGGATTGCTGGTGATCCCCAAGGGGATGGCCATTAGGGTG
ATGAAGAACCTGAGGATGTGCCGTGACTGCCATGAAGCGTTTAAGGTCATCAGTGCCATT
GTGGAGAGGGAGTTCGTTGTCAGGGATCTCAACAGGTTCCACCACTTCAGGATGGGGTCA
TGTTCTTGCAATGACTACTGGTGATTCAATCAAAGGCTAGAATCAGTTACTCCCATCTTG
CAATGATTACTGGTGATTCAATCAAAGGCTAGAATCAGTtactcccacagtcctaaaata
taagaacctaaaaccggatgtgacatttcctagtataatgaatcttaagaggcactaaaa
aatgtctcattcaattctaggttcttctattttgggacggatggagtaGTAGGAAGAAAC
CAGGTCATGTTCTTGCAATGACTACTGGTGATGCAATCAAAGGCTAAATCGGTTGGTAGT
TGTGATCTTTTTGACATAAAAGGAAGACAGCCTTGACAGAATTTCTTTGTGTAGATGCAG
AACTGAAGTGACTTCTTTCGTTGCGAGCCTGTAGGTAGGTACCAAAGGTCCACAGCATTG
CTTGAAAATATAGACACAAACGAACATGGCCTGGGGTTGGAGTTGGCCCCAACTTTGTTG
AAACTGGGTTTGTTTTATGATATGTCTTTGTGCTCTAGTAATAAAtatttgatatttatg
ataaagtttgatcaaactcttaaattttgattatcaataatttctcaagtgatagttttt
aataacatgtacatagagtactatcataaatatcataaacttattt

CDS

1815 bp

>Os12t0163600-01 Pentatricopeptide repeat protein, Organellar RNA editing
ATGACGGCGACATCCAACGCCGCCGCCGGCGCGGCCACGCTGATGCCGCTGCTGATCCAC
CTCCTTCGCGGCGCCTCCGACCTCGCCTCCGTGTCCGCCACCCACGCCAAGCTCCTCAAG
CTCGGGGCGGCCTCCTCGGTCGCCTCCTCCAACCACCTCCTCGCGGCGTACGGCCGCTGC
GGCTGCACCGCCCTCGCGCGCCACCTGTTCGACGGAATGCGCGACCGGAACGTCGTCTCC
TGGACGGCCCTCATGTCCGGGTACGCCAGCGCCGGCCGGCCCCGGGCGGCCGTCGCCCTC
CTCCGCGCCATGGCACGCAGCGGCGTGCCACCCAACGCCTTCACCTTCTCTACAGCTGCC
AGCTCGTGCGCGCGCCTGGCTGACGCCGGCCTTGGGCGGCAggtgcatgcccgcgctgag
gtcgcggggtacgcgtgcgacagcgtcgtttccactgcgctcGTCGACATGTACGGCAAG
GCCGGCAGGGTCGGGGACGCCCGCGCTGTGTTCGACGCAATGCCCGTGACGGCGAGAAAC
GCGGTTTCCTGGGCCTCGATGCTGTCGGTGTATGCGCAGAACGCGCTCGGGCATGACGCT
ATCCAGCTCTTCGCCGAGCTCAGAACCAATGGCGAAGACATGGCGCCCAACCACTTCATG
CTGTCAAGCGTGGTGAACGCGTGCGCGGGCGTCGGGCGGCTTGGCATCGGCAAGTGCATT
CACGGCATGGTCCTCCACCATGGGCACGAAGACAATGACGTGGTTGCAGTGGCTCTGGTT
GACATGTACTCCAAATGTGGCATCTACGAGTACTCAAAGAAGGTGTTCGACAGGATCAAC
CAGCCGTCGGTCATCCCCTACACCTCCATCATCGTGGCGACGGCGAAGTACGGCCTCGGC
AGGTGCGCACTCGCTTTGTTCAGTGACATGGTTGGCCGAGGCGTGCAGCCAAACAGTGTC
ACACTGCTCGGCGTCCTGCACGCTTGCAGCCACTCAGGTCTGGTCGACACCGGCCTCCAG
CTCCTCCGTTCAATGCGAAGCGAGTACGGCATTGATCCATGTGCCAGCCACTACACTTGT
GCTGTCGACATGCTCGGTCGTGCAGGTCAGCTCGAGGCGGCATTCGAGCTGGCCGACGAA
GCACAGGTCAATGGCAATGACGCCCTCATGCTGTGGAGCTCATTGCTGTCAGCTTGCCGG
AACCACAAGCGCCTGGACCTAGCAACCATGGCTGGGCAGAAGGTATCAGAGTTCACCCAA
GATGTGGCCGGCGCACTGGTGGTCATGTCGAACGCATACGCTTCAGCCGGTCAAGCCGAC
GACGCTGCTGCGGTGTGGTCGAACATGAGGCGGCGCGGCATTCGGAAGGATCCCGGGTGC
AGCTGGATCGAGATAAAGGACATCTCCTACGTGTTCTACGCTGGCATGGTATCGCCTGCC
GGCTCAAGGGCCGGTGAGGTGATGCTGCTGTTAGATGAATTGGAGGGCAAGATGAGGGAG
AAGGGTTACAAGGGGAGAATTGGCAGTGCCAGAGTCCTTGATGCTGATGAAGAAGAGGAT
GGAAATCATCATCATCAGGAAGGCAGAGGTGTGATGGTTGGAGTGCACAGTGAGTTGCTG
GCATTGGGGCTTGGATTGCTGGTGATCCCCAAGGGGATGGCCATTAGGGTGATGAAGAAC
CTGAGGATGTGCCGTGACTGCCATGAAGCGTTTAAGGTCATCAGTGCCATTGTGGAGAGG
GAGTTCGTTGTCAGGGATCTCAACAGGTTCCACCACTTCAGGATGGGGTCATGTTCTTGC
AATGACTACTGGTGA

Protein

605 aa

>Os12t0163600-01 Pentatricopeptide repeat protein, Organellar RNA editing
MTATSNAAAGAATLMPLLIHLLRGASDLASVSATHAKLLKLGAASSVASSNHLLAAYGRC
GCTALARHLFDGMRDRNVVSWTALMSGYASAGRPRAAVALLRAMARSGVPPNAFTFSTAA
SSCARLADAGLGRQVHARAEVAGYACDSVVSTALVDMYGKAGRVGDARAVFDAMPVTARN
AVSWASMLSVYAQNALGHDAIQLFAELRTNGEDMAPNHFMLSSVVNACAGVGRLGIGKCI
HGMVLHHGHEDNDVVAVALVDMYSKCGIYEYSKKVFDRINQPSVIPYTSIIVATAKYGLG
RCALALFSDMVGRGVQPNSVTLLGVLHACSHSGLVDTGLQLLRSMRSEYGIDPCASHYTC
AVDMLGRAGQLEAAFELADEAQVNGNDALMLWSSLLSACRNHKRLDLATMAGQKVSEFTQ
DVAGALVVMSNAYASAGQADDAAAVWSNMRRRGIRKDPGCSWIEIKDISYVFYAGMVSPA
GSRAGEVMLLLDELEGKMREKGYKGRIGSARVLDADEEEDGNHHHQEGRGVMVGVHSELL
ALGLGLLVIPKGMAIRVMKNLRMCRDCHEAFKVISAIVEREFVVRDLNRFHHFRMGSCSC
NDYW*

5'UTR

chr12:3228956..3229144 (- strand) : 189 bp

CDS

chr12:3227141..3228955 (- strand) : 1815 bp

3'UTR

chr12:3226519..3227140 (- strand) : 622 bp

FASTA

>Os12t0163600-01 class=Sequence position=chr12:3226519..3229144 (- strand)
GAAATGAAAC GATCTGGTTG CCTTCTCCGG TTCTCCCCAA GCAAACACGG ACTAGGGCCT GCGCCGCGGC GGCGGCGGCG
GCGGCGCTGC TTTTCCCCGG CGCGCCCCGT CCCCGGCAGC GGCTCCTCCG GCGTGGTACC TCCCAAGCGC TTCCGATCCT
CGACATGACA CTGGCACCAA CCGGTCTCCA TGACGGCGAC ATCCAACGCC GCCGCCGGCG CGGCCACGCT GATGCCGCTG
CTGATCCACC TCCTTCGCGG CGCCTCCGAC CTCGCCTCCG TGTCCGCCAC CCACGCCAAG CTCCTCAAGC TCGGGGCGGC
CTCCTCGGTC GCCTCCTCCA ACCACCTCCT CGCGGCGTAC GGCCGCTGCG GCTGCACCGC CCTCGCGCGC CACCTGTTCG
ACGGAATGCG CGACCGGAAC GTCGTCTCCT GGACGGCCCT CATGTCCGGG TACGCCAGCG CCGGCCGGCC CCGGGCGGCC
GTCGCCCTCC TCCGCGCCAT GGCACGCAGC GGCGTGCCAC CCAACGCCTT CACCTTCTCT ACAGCTGCCA GCTCGTGCGC
GCGCCTGGCT GACGCCGGCC TTGGGCGGCA ggtgcatgcc cgcgctgagg tcgcggggta cgcgtgcgac agcgtcgttt
ccactgcgct cGTCGACATG TACGGCAAGG CCGGCAGGGT CGGGGACGCC CGCGCTGTGT TCGACGCAAT GCCCGTGACG
GCGAGAAACG CGGTTTCCTG GGCCTCGATG CTGTCGGTGT ATGCGCAGAA CGCGCTCGGG CATGACGCTA TCCAGCTCTT
CGCCGAGCTC AGAACCAATG GCGAAGACAT GGCGCCCAAC CACTTCATGC TGTCAAGCGT GGTGAACGCG TGCGCGGGCG
TCGGGCGGCT TGGCATCGGC AAGTGCATTC ACGGCATGGT CCTCCACCAT GGGCACGAAG ACAATGACGT GGTTGCAGTG
GCTCTGGTTG ACATGTACTC CAAATGTGGC ATCTACGAGT ACTCAAAGAA GGTGTTCGAC AGGATCAACC AGCCGTCGGT
CATCCCCTAC ACCTCCATCA TCGTGGCGAC GGCGAAGTAC GGCCTCGGCA GGTGCGCACT CGCTTTGTTC AGTGACATGG
TTGGCCGAGG CGTGCAGCCA AACAGTGTCA CACTGCTCGG CGTCCTGCAC GCTTGCAGCC ACTCAGGTCT GGTCGACACC
GGCCTCCAGC TCCTCCGTTC AATGCGAAGC GAGTACGGCA TTGATCCATG TGCCAGCCAC TACACTTGTG CTGTCGACAT
GCTCGGTCGT GCAGGTCAGC TCGAGGCGGC ATTCGAGCTG GCCGACGAAG CACAGGTCAA TGGCAATGAC GCCCTCATGC
TGTGGAGCTC ATTGCTGTCA GCTTGCCGGA ACCACAAGCG CCTGGACCTA GCAACCATGG CTGGGCAGAA GGTATCAGAG
TTCACCCAAG ATGTGGCCGG CGCACTGGTG GTCATGTCGA ACGCATACGC TTCAGCCGGT CAAGCCGACG ACGCTGCTGC
GGTGTGGTCG AACATGAGGC GGCGCGGCAT TCGGAAGGAT CCCGGGTGCA GCTGGATCGA GATAAAGGAC ATCTCCTACG
TGTTCTACGC TGGCATGGTA TCGCCTGCCG GCTCAAGGGC CGGTGAGGTG ATGCTGCTGT TAGATGAATT GGAGGGCAAG
ATGAGGGAGA AGGGTTACAA GGGGAGAATT GGCAGTGCCA GAGTCCTTGA TGCTGATGAA GAAGAGGATG GAAATCATCA
TCATCAGGAA GGCAGAGGTG TGATGGTTGG AGTGCACAGT GAGTTGCTGG CATTGGGGCT TGGATTGCTG GTGATCCCCA
AGGGGATGGC CATTAGGGTG ATGAAGAACC TGAGGATGTG CCGTGACTGC CATGAAGCGT TTAAGGTCAT CAGTGCCATT
GTGGAGAGGG AGTTCGTTGT CAGGGATCTC AACAGGTTCC ACCACTTCAG GATGGGGTCA TGTTCTTGCA ATGACTACTG
GTGATTCAAT CAAAGGCTAG AATCAGTTAC TCCCATCTTG CAATGATTAC TGGTGATTCA ATCAAAGGCT AGAATCAGTt
actcccacag tcctaaaata taagaaccta aaaccggatg tgacatttcc tagtataatg aatcttaaga ggcactaaaa
aatgtctcat tcaattctag gttcttctat tttgggacgg atggagtaGT AGGAAGAAAC CAGGTCATGT TCTTGCAATG
ACTACTGGTG ATGCAATCAA AGGCTAAATC GGTTGGTAGT TGTGATCTTT TTGACATAAA AGGAAGACAG CCTTGACAGA
ATTTCTTTGT GTAGATGCAG AACTGAAGTG ACTTCTTTCG TTGCGAGCCT GTAGGTAGGT ACCAAAGGTC CACAGCATTG
CTTGAAAATA TAGACACAAA CGAACATGGC CTGGGGTTGG AGTTGGCCCC AACTTTGTTG AAACTGGGTT TGTTTTATGA
TATGTCTTTG TGCTCTAGTA ATAAAtattt gatatttatg ataaagtttg atcaaactct taaattttga ttatcaataa
tttctcaagt gatagttttt aataacatgt acatagagta ctatcataaa tatcataaac ttattt

Locus: Os12g0163600

Loading...

Locus: Os12g0163600

Loading...