Os12t0169400-01

Locus

Os12g0169400

Description

Cystathionine beta-synthase, core domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsCBSCBSPB4, CBSCBSPB4

Oryzabase Gene Name Synonym(s)

cystathionine b-synthase domain containing protein OsCBSCBSPB4, CBS domain containing protein OsCBSCBSPB4

Transcript Evidence

AK069406 (DDBJ, Best hit)

Protein Evidence

NP_001148069.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

Phox/Bem1p (IPR000270)

Cystathionine beta-synthase, core (IPR000644)

Aldolase-type TIM barrel (IPR013785)

Full-length cDNA

J023014B04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0169400-01)

RiceXPro (AK069406)

Others

Oryzabase (10354)

KEGG (Os12t0169400-01)

Transcript

2096 bp

>Os12t0169400-01 Cystathionine beta-synthase, core domain containing protein.
GAAGCGCAAAAAACCCACGCGCTGTCGCAGGAGAAACGAAGCCGAAGCTCCCATTTCCAT
TCCACCTGCTCTCCCAACTCTCCGGCCGCCGCCGCCGCCGCCGCCGCCGCCGCGCTAACC
TCCTCCCCGCGACGAGCGCCACCATGAGCACGGCCTCGGCGACGGCGCCGCCGAGCCGCC
GGACGCGGAGCCGCCCGCCGTCGGCGTCCTCCCGCAAGTCCGACGACCCCTCCGCCGCCG
CCGCCAACGGGAACGGGAAGGCCTCCTCCAAGCCCACCTCCCCCGGCCAGCTGACCGGGG
AGAGGACGGTGAGGAAGCTGAGGCTGTCCAAGGCGCTGACGATACCGGAGGGGACGACGG
TGTCGGAGGCGTGCAGGAGGATGGCGGCGAGGAGGGTCGACGCCGTGCTGCTCACCGACG
CGCAGGGCCTCCTCTCCGGCATCGTCACTGATAAGGATGTAGCTACAAGGGTGGTTGCTG
AGGGGCTGCGGGTGGAGCAAACCATCATGTCCAAGATCATGACAAGGAACCCCACATATG
CCATGTCTGATACGCTTGCCATTGAAGCATTGCAGAAGATGGTTCAAGGTAAATTTAGAC
ACCTCCCAGTTGTGGAAAATGGTGAGGTTATTGCTATGCTGGACATTGCTAAATGCCTTT
ACGATGCAATATCAAGACTGGAAAAGGCAGCAGAACAAGGGAGTGCAATAGCAGCTGCTG
TAGAAGGGGTAGAGCGTCAATTAGGAGGCAACTTTTCAGCTCCTTATGCTTTCATAGAAA
CTCTAAGAGAGAGGATGTTCAAACCTTCTTTGTCAACCATTGTCACGGAGGGCACAAAGG
TAGCAATTGTTTCTCCTTCAGACCCAGTGTATGTAGCAACACAGAAAATGCGTGAATTTC
GAGTTAATTCGGTGGTTGTTGCTACAGGAAACACACTACAGGGGATCTTCACCTCAAAGG
ATTTGCTTATGCGTGTTGTTGCACAGAATCTTTCTCCTGAATTGACCCTAGTAGAAAAGG
TGATGACTGTAAACCCAGATTTTGCTACATTAGACACGACAATTCTTGATGCTCTACATA
TAATGCATGATGGAAAGTTCTTGCATATTCCTGTTCTTGATCGAGAAGGACAAATTGCTG
CTTGCTTGGATGTCCTGCAACTTACCCACGCAGCCATTCAATTGGTTGAAGGAGGAAATG
ACACTGTAAATGATGTGGCAAATACAGTAATGCAGAGGTTTTGGGATTCTACTCTTGCTT
TGGAGTCTCCTGATGAGGAATGCGATAGCCGTAGTGAAGTATCATTGCTCTTGGCATCAG
AAACTGGAGATGGAAAGAGTAGCATTTACCCCCCTGTTATTGGAAATTCGTTTGCCTTTA
AGCTTCAAGACCAAAAGGGACGCGTGCATAGATTCACTTGTGGCTCAGAGAGCTTAAACG
AGCTAGCGTCTTCTATAAAACAAAGATTAAGTATTACTGACGAAGAGGGCATAATGCAAC
TCCTGTACGAAGACGATGAAGGTGACCGGGTGCTACTGACAACTGATGCCGATCTTGCTG
GTGCCGTGCTCCATGCCAAATCGTCCGGTTTGAAGGTTCTGAAGTTGCATATCGACCTGT
CTGAATCCAGCACAGAGGTGACAAAGCCATCACAGCAGCTGGCAGCTGCACGCAGGAGTC
GGTTGTCGCCTGTTCGTGTTGGGCTGATGGCTGGTGTGGTCGCTCTCAGCGGTGCAGCAG
TGATGGTTTACCTGAAACGAGCTAAAGTGTGATTTCCCCATGAATTACTGGTAATTTTTT
CAAACCTGTATTTTTTCCAGTTCCTGGAGCTAATTATGCATCATGCCAAAGAAATGACAC
ATTGGAGAGCAACCAAAGTTGCATCAGATGCACTGAAACTCTCTGACGCCGGGCTGAAGA
ATCTGCCTATGTTGGTTTTTGTTTCCTCAATTTGCACGCATATCAGCAAATTTCACTAGT
ACTGTGAAATGTATAAACATTAGGATGTTCCTAGTTCATATTTATGTACTTGTTTACAGA
TAAACAGATATGTAAACTCATTTTGAAGGACAGAAGTAAATAGATCCTTCTCTCCT

CDS

1629 bp

>Os12t0169400-01 Cystathionine beta-synthase, core domain containing protein.
ATGAGCACGGCCTCGGCGACGGCGCCGCCGAGCCGCCGGACGCGGAGCCGCCCGCCGTCG
GCGTCCTCCCGCAAGTCCGACGACCCCTCCGCCGCCGCCGCCAACGGGAACGGGAAGGCC
TCCTCCAAGCCCACCTCCCCCGGCCAGCTGACCGGGGAGAGGACGGTGAGGAAGCTGAGG
CTGTCCAAGGCGCTGACGATACCGGAGGGGACGACGGTGTCGGAGGCGTGCAGGAGGATG
GCGGCGAGGAGGGTCGACGCCGTGCTGCTCACCGACGCGCAGGGCCTCCTCTCCGGCATC
GTCACTGATAAGGATGTAGCTACAAGGGTGGTTGCTGAGGGGCTGCGGGTGGAGCAAACC
ATCATGTCCAAGATCATGACAAGGAACCCCACATATGCCATGTCTGATACGCTTGCCATT
GAAGCATTGCAGAAGATGGTTCAAGGTAAATTTAGACACCTCCCAGTTGTGGAAAATGGT
GAGGTTATTGCTATGCTGGACATTGCTAAATGCCTTTACGATGCAATATCAAGACTGGAA
AAGGCAGCAGAACAAGGGAGTGCAATAGCAGCTGCTGTAGAAGGGGTAGAGCGTCAATTA
GGAGGCAACTTTTCAGCTCCTTATGCTTTCATAGAAACTCTAAGAGAGAGGATGTTCAAA
CCTTCTTTGTCAACCATTGTCACGGAGGGCACAAAGGTAGCAATTGTTTCTCCTTCAGAC
CCAGTGTATGTAGCAACACAGAAAATGCGTGAATTTCGAGTTAATTCGGTGGTTGTTGCT
ACAGGAAACACACTACAGGGGATCTTCACCTCAAAGGATTTGCTTATGCGTGTTGTTGCA
CAGAATCTTTCTCCTGAATTGACCCTAGTAGAAAAGGTGATGACTGTAAACCCAGATTTT
GCTACATTAGACACGACAATTCTTGATGCTCTACATATAATGCATGATGGAAAGTTCTTG
CATATTCCTGTTCTTGATCGAGAAGGACAAATTGCTGCTTGCTTGGATGTCCTGCAACTT
ACCCACGCAGCCATTCAATTGGTTGAAGGAGGAAATGACACTGTAAATGATGTGGCAAAT
ACAGTAATGCAGAGGTTTTGGGATTCTACTCTTGCTTTGGAGTCTCCTGATGAGGAATGC
GATAGCCGTAGTGAAGTATCATTGCTCTTGGCATCAGAAACTGGAGATGGAAAGAGTAGC
ATTTACCCCCCTGTTATTGGAAATTCGTTTGCCTTTAAGCTTCAAGACCAAAAGGGACGC
GTGCATAGATTCACTTGTGGCTCAGAGAGCTTAAACGAGCTAGCGTCTTCTATAAAACAA
AGATTAAGTATTACTGACGAAGAGGGCATAATGCAACTCCTGTACGAAGACGATGAAGGT
GACCGGGTGCTACTGACAACTGATGCCGATCTTGCTGGTGCCGTGCTCCATGCCAAATCG
TCCGGTTTGAAGGTTCTGAAGTTGCATATCGACCTGTCTGAATCCAGCACAGAGGTGACA
AAGCCATCACAGCAGCTGGCAGCTGCACGCAGGAGTCGGTTGTCGCCTGTTCGTGTTGGG
CTGATGGCTGGTGTGGTCGCTCTCAGCGGTGCAGCAGTGATGGTTTACCTGAAACGAGCT
AAAGTGTGA

Protein

543 aa

>Os12t0169400-01 Cystathionine beta-synthase, core domain containing protein.
MSTASATAPPSRRTRSRPPSASSRKSDDPSAAAANGNGKASSKPTSPGQLTGERTVRKLR
LSKALTIPEGTTVSEACRRMAARRVDAVLLTDAQGLLSGIVTDKDVATRVVAEGLRVEQT
IMSKIMTRNPTYAMSDTLAIEALQKMVQGKFRHLPVVENGEVIAMLDIAKCLYDAISRLE
KAAEQGSAIAAAVEGVERQLGGNFSAPYAFIETLRERMFKPSLSTIVTEGTKVAIVSPSD
PVYVATQKMREFRVNSVVVATGNTLQGIFTSKDLLMRVVAQNLSPELTLVEKVMTVNPDF
ATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHAAIQLVEGGNDTVNDVAN
TVMQRFWDSTLALESPDEECDSRSEVSLLLASETGDGKSSIYPPVIGNSFAFKLQDQKGR
VHRFTCGSESLNELASSIKQRLSITDEEGIMQLLYEDDEGDRVLLTTDADLAGAVLHAKS
SGLKVLKLHIDLSESSTEVTKPSQQLAAARRSRLSPVRVGLMAGVVALSGAAVMVYLKRA
KV*

5'UTR

chr12:3536284..3536426 (- strand) : 143 bp

CDS

chr12:3536132..3536283 (- strand) : 152 bp

chr12:3535875..3536034 (- strand) : 160 bp

chr12:3535176..3535308 (- strand) : 133 bp

chr12:3533996..3534166 (- strand) : 171 bp

chr12:3533659..3533737 (- strand) : 79 bp

chr12:3533448..3533561 (- strand) : 114 bp

chr12:3533299..3533365 (- strand) : 67 bp

chr12:3533092..3533197 (- strand) : 106 bp

chr12:3532935..3532993 (- strand) : 59 bp

chr12:3532730..3532839 (- strand) : 110 bp

chr12:3532524..3532651 (- strand) : 128 bp

chr12:3532349..3532431 (- strand) : 83 bp

chr12:3532011..3532100 (- strand) : 90 bp

chr12:3531719..3531895 (- strand) : 177 bp

3'UTR

chr12:3531395..3531718 (- strand) : 324 bp

FASTA

>Os12t0169400-01 class=Sequence position=chr12:3531395..3536426 (- strand)
GAAGCGCAAA AAACCCACGC GCTGTCGCAG GAGAAACGAA GCCGAAGCTC CCATTTCCAT TCCACCTGCT CTCCCAACTC
TCCGGCCGCC GCCGCCGCCG CCGCCGCCGC CGCGCTAACC TCCTCCCCGC GACGAGCGCC ACCATGAGCA CGGCCTCGGC
GACGGCGCCG CCGAGCCGCC GGACGCGGAG CCGCCCGCCG TCGGCGTCCT CCCGCAAGTC CGACGACCCC TCCGCCGCCG
CCGCCAACGG GAACGGGAAG GCCTCCTCCA AGCCCACCTC CCCCGGCCAG CTGACGTAAG CACACCGAGC CTGCGAACCC
TTCCTTCCGT TCCTTCTCTC CTTTGGTTCG TAGCCGCTGA ATGATTTTGG GGGTTTCTTC TGTTGGTTGA AGCGGGGAGA
GGACGGTGAG GAAGCTGAGG CTGTCCAAGG CGCTGACGAT ACCGGAGGGG ACGACGGTGT CGGAGGCGTG CAGGAGGATG
GCGGCGAGGA GGGTCGACGC CGTGCTGCTC ACCGACGCGC AGGGCCTCCT CTCCGGCATC GTCACTGATA AGGTACAGGA
TTTTCTTTGC TTGCCCCCTC CCAATCTGTT GGAAATTTGG AATTTCTAGT GTGCTTTTAT AGATGCTGAT TTTGGAAGAT
AGAAGATGGT TTGATTCTTT CAATTTGATG CTATGCGGAT GCGACACCTT CTCGTTGCTC TTTTGAAAAA CATCGATGCC
TGGATTGGAT TCTCAGTTTG GAGCATAGCA AGTGGCTTTT TGTGGGTGTC AAAGTTTAAG ATATTTTGTT CTCCTTTAGA
TTTTGGATGT TTTCATCCAA AAAATTAGGA GTCATTTTTG TTGACCATGT GTTCACTAGT CTCTGCAATT ATACATTTAT
ACTTATTGAT GCATACTTTT CCTCTGCCTT TTCTTTTTCA TTCGGTTTTG GCAAAAAAGG TAGAATTAGT TAAGGTAAAG
TGAAGTCGAT TTCCACTAAG CCATGGAGTT CAATTTATGC TTTTTACTCT GCTGTGAACC AAAAAGCCAA CATGCTTTGC
ACTTGGTCTA ATTTTAGTAC TACGATTCGA GATGAAGATG GTTCTTGTTT TCATTCTTTT TCGGGATTCC AATCGCAGGA
TGTAGCTACA AGGGTGGTTG CTGAGGGGCT GCGGGTGGAG CAAACCATCA TGTCCAAGAT CATGACAAGG AACCCCACAT
ATGCCATGTC TGATACGCTT GCCATTGAAG CATTGCAGAA GATGGTTCAA GGTATGTCAG ACGCACTCCA TTTTTTTTAC
ACTTTCTTGG CTAAAACATC TATAGGGACA ATGTAACAGT GAAATTGAGC TGGCTAAATT CAATTCCCCT GTCATCTTAT
AAAATGTTCT TTCATATGAT TGAGATTGTA GCAGATTAGC CAGTCATTTC TATTATTATT TTAGCTGTAG TGACTAGTGC
CACTTCAAGT CATTTTCGCT ATCATGATGC ATAATTCTTT CGCCAATGAT TCACTAAATT GTAGTACTTA ACATAAAGTA
CTCGGTTAAA CAAATTGGGA GCACCTAATT GAGAATCGGC ACATGTCAAT TTTGTTAGAG CTTTGTGAAA CGGGGATAAT
TCACAGTACT AAATGAAGGT ATACTGCACC TAGTAGAGCA TTAAAAGAAT GGAGTACTTG TTTGCTGTGT ATTGCTTGTT
CTCCTTTTTT TTTTGTTTTT CGAAAAAGGG TGCAGGAGTT TTGTCCCATT AATTTATAGC AGGGAGAGAA CAAAAAAGCA
ATATCCAGAA ATTACATGAT GGGTAAGCCC TCGAAAGGCT GACAGAGAGA GGAAAACTAA AAAAGCCCTG ATGTTGGAGG
CCAACTTAGT ATTCTCTTTG CATGATCATG CTTTCAACTT TCAAGTACTA TCTTAGATGA AAAATATGAT GTTTTCTTGT
TGTATTTTGT TACGCATACT GTTTTTGTAT GTCACCATCA GATCAGCTCA ATCTGCCCCT TTTTCTGTGT GTGCAATGAA
AGGCAAAAGC ACATTTTTTG GTAATGTTAG GCATCTTAGC TGTCTTGGAA TCTCAATATC TCCAGCAAAA GAAATTGAAG
ATTCCTTGAT TTGTATCGTC AGACGTCTAA GATTTCTTTG GTATGCCCTG AACTTCAGTG GCATATATGT AGGCTGGTTG
TTTCACTTTG TTACACATAG ACCTTGGTTG GCTAGAAATT AGTCCCTTTT TCACAAACAT ACTGACTGTA GTTTCTTTAA
AATGTTCATA CATATTTTAG GTAAATTTAG ACACCTCCCA GTTGTGGAAA ATGGTGAGGT TATTGCTATG CTGGACATTG
CTAAATGCCT TTACGATGCA ATATCAAGAC TGGAAAAGGC AGCAGAACAA GGGAGTGCAA TAGCAGCTGC TGTAGAAGGG
GTAGAGCGTC AATTAGGAGG CAACTTTTCA GGTACTGCAC TGGATATTAT TATCAATTAC TTCACTCTTT CTCACTCTTG
AAACTGAAAG TACACCGTGC ATAACATGTA CTATTTATGG TACATTTTAT GGATTATCAC TTTTCATGTT GCTATATACA
TCTTTTAAAT AAAATATGTC GAACAACTTA TCAGGTATAT CATATTCTAC TAGACTATTA TATGTGTTTG TTTATCATAA
TTATATTTGG TAATGATCAA TTTAAGGTAT TCTCTGTTTG TGGATACAGC TCCTTATGCT TTCATAGAAA CTCTAAGAGA
GAGGATGTTC AAACCTTCTT TGTCAACCAT TGTCACGGAG GGCACAAAGT ACAGTAACTG CTTTCTCTTA CTATTTTCTG
TTAACTTTTA GCAAAAAAGA ATGAATAGTG AGAGTTTTCT CTGACTATTT TCTGTTAATT TTCAGGGTAG CAATTGTTTC
TCCTTCAGAC CCAGTGTATG TAGCAACACA GAAAATGCGT GAATTTCGAG TTAATTCGGT GGTTGTTGCT ACAGGAAACA
CACTACAGGG GATCTTCACG TGAGCAATCT ATTTTAGTAC TTCTACTATT ATTTACAACT TCCTTATTTT TCTTCTACTT
TACTGATGCA TCCAAATGCA GCTCAAAGGA TTTGCTTATG CGTGTTGTTG CACAGAATCT TTCTCCTGAA TTGACCCTAG
TAGAAAAGGT TTCTCCACCA GATTTACATT TTCTTGCCTC TTCCGATGCC ATCTGAGCTT TGTTTAATTG CATATGAACT
CACTGTGTTA CTTTCAATTA TTTTTGAAGG TGATGACTGT AAACCCAGAT TTTGCTACAT TAGACACGAC AATTCTTGAT
GCTCTACATA TAATGCATGA TGGAAAGTTC TTGCATATTC CTGTTCTTGA TCGAGGTAGA GCCTTATTCA TGTCTCTGCG
TCCCAAAAGG ACAATAACAA AGCATCTTCT GGGACTTTAT TATTTGATGC TTGTCTTACA TTTTCCTCAA CAGAAGGACA
AATTGCTGCT TGCTTGGATG TCCTGCAACT TACCCACGCA GCCATTCAAT TGGTGGTCCC TTATCCCAAA CTCCTTAATT
TCTGATAGTT CTTCCACTCT GCGGTAGATT CCCATGCTAA GCTTCTGAAT GCATTCTCAA TTTGTAGGTT GAAGGAGGAA
ATGACACTGT AAATGATGTG GCAAATACAG TAATGCAGAG GTTTTGGGAT TCTACTCTTG CTTTGGAGTC TCCTGATGAG
GAATGCGATA GCCGTAGGTC TGTTGATGGT TTTCATTTGT TGAATGTTTC GCTCACTTGC TCTCCCCTAA TACAATTCTC
TTCTACATTT CCCAGTGAAG TATCATTGCT CTTGGCATCA GAAACTGGAG ATGGAAAGAG TAGCATTTAC CCCCCTGTTA
TTGGAAATTC GTTTGCCTTT AAGCTTCAAG ACCAAAAGGG ACGCGTGCAT AGATTCACTT GTGGTAATTG CTCTCCTGAT
AGTTTGCACA AGTATGTTGA TTGTTCTCAT ATCATTCAAA CATAACTGTT CTTAACTTCT TTTCTCTTGC TGCAGGCTCA
GAGAGCTTAA ACGAGCTAGC GTCTTCTATA AAACAAAGAT TAAGTATTAC TGACGAAGAG GGCATAATGC AACTCCTGGT
ACAACTGAGT ATTTGTCATA AGAATATTTC TAGTGCTTTC ATAATCATGT GTAACAAAGA GACGAAATAT TCGCTGCCTT
AATGTACTCT ACTTCGAGAG CGAAGCTATT GCTATGAGCT TATATGCATG TATTTATGTC CTCTAAACCT GTAATTATTG
TCTTTGCACT GCACCACTAA GGCACTTACT AGAGGACAGC CAATATTTCA AGCACTTCCC CACTTAATCT TGTTTGTTCT
ATGTAGTACG AAGACGATGA AGGTGACCGG GTGCTACTGA CAACTGATGC CGATCTTGCT GGTGCCGTGC TCCATGCCAA
ATCGTCCGGT TTGAAGGTAT CTGTTGTTCT TGGACTCTTG GTACTATAGT TTACTCTATG TAGCAACTCG TAGAGCTCTC
CAACTTTTCT TGCTTCCATC TATCTCACTA CTATGAATAT CTCATTGTCA GGTTCTGAAG TTGCATATCG ACCTGTCTGA
ATCCAGCACA GAGGTGACAA AGCCATCACA GCAGCTGGCA GCTGCACGCA GGAGTCGGTT GTCGCCTGTT CGTGTTGGGC
TGATGGCTGG TGTGGTCGCT CTCAGCGGTG CAGCAGTGAT GGTTTACCTG AAACGAGCTA AAGTGTGATT TCCCCATGAA
TTACTGGTAA TTTTTTCAAA CCTGTATTTT TTCCAGTTCC TGGAGCTAAT TATGCATCAT GCCAAAGAAA TGACACATTG
GAGAGCAACC AAAGTTGCAT CAGATGCACT GAAACTCTCT GACGCCGGGC TGAAGAATCT GCCTATGTTG GTTTTTGTTT
CCTCAATTTG CACGCATATC AGCAAATTTC ACTAGTACTG TGAAATGTAT AAACATTAGG ATGTTCCTAG TTCATATTTA
TGTACTTGTT TACAGATAAA CAGATATGTA AACTCATTTT GAAGGACAGA AGTAAATAGA TCCTTCTCTC CT

Locus: Os12g0169400

Loading...

Locus: Os12g0169400

Loading...