Os12t0177900-00

Locus

Os12g0177900

Description

Similar to Aldehyde dehydrogenase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

ALDH3H1

CGSNL Gene Name

ALDEHYDE DEHYDROGENASE 3H1

Oryzabase Gene Symbol Synonym(s)

OsALDH3H1

Oryzabase Gene Name Synonym(s)

Aldehyde dehydrogenase 3H1

Transcript Evidence

ab initio prediction

Protein Evidence

Q2QWY3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: metabolic process (GO:0008152)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: oxidoreductase activity (GO:0016491)

Functional domain (InterPro)

Aldehyde dehydrogenase, N-terminal (IPR016162)

Expression Databases

TENOR (Os12t0177900-00)

Others

Oryzabase (22113)

KEGG (Os12t0177900-00)

Transcript

252 bp

>Os12t0177900-00 Similar to Aldehyde dehydrogenase.
ATGGCGGCGGCGAGGAGCGTGGGGATGGAGGCGGAGGTGGCGGCGCTGCGGGGGAGGTTC
GCGGCGGGGGGGACGCGGGGCGCGGAGTGGCGGGCGGCGCAGCTCCGCGGGATCCTGCGG
ATGGCGGCGGAGGCGGAGGCGGAGGTGTGCCGCGCCCTCCACGCCGACCTCGCCAAGCCC
TACACCGAGTCCTACGTCCACGAGGCAAATCCAATCTCTCCCTTCTTCCTCTTCTTTCTT
CCTATAAAATAA

CDS

252 bp

>Os12t0177900-00 Similar to Aldehyde dehydrogenase.
ATGGCGGCGGCGAGGAGCGTGGGGATGGAGGCGGAGGTGGCGGCGCTGCGGGGGAGGTTC
GCGGCGGGGGGGACGCGGGGCGCGGAGTGGCGGGCGGCGCAGCTCCGCGGGATCCTGCGG
ATGGCGGCGGAGGCGGAGGCGGAGGTGTGCCGCGCCCTCCACGCCGACCTCGCCAAGCCC
TACACCGAGTCCTACGTCCACGAGGCAAATCCAATCTCTCCCTTCTTCCTCTTCTTTCTT
CCTATAAAATAA

Protein

84 aa

>Os12t0177900-00 Similar to Aldehyde dehydrogenase.
MAAARSVGMEAEVAALRGRFAAGGTRGAEWRAAQLRGILRMAAEAEAEVCRALHADLAKP
YTESYVHEANPISPFFLFFLPIK*

CDS

chr12:3947161..3947412 (+ strand) : 252 bp

FASTA

>Os12t0177900-00 class=Sequence position=chr12:3947161..3947412 (+ strand)
ATGGCGGCGG CGAGGAGCGT GGGGATGGAG GCGGAGGTGG CGGCGCTGCG GGGGAGGTTC GCGGCGGGGG GGACGCGGGG
CGCGGAGTGG CGGGCGGCGC AGCTCCGCGG GATCCTGCGG ATGGCGGCGG AGGCGGAGGC GGAGGTGTGC CGCGCCCTCC
ACGCCGACCT CGCCAAGCCC TACACCGAGT CCTACGTCCA CGAGGCAAAT CCAATCTCTC CCTTCTTCCT CTTCTTTCTT
CCTATAAAAT AA

Locus: Os12g0177900

Loading...

Locus: Os12g0177900

Loading...