Os12t0178100-01

Locus

Os12g0178100

Description

Haem peroxidase family protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

APX6

CGSNL Gene Name

ASCORBATE PEROXIDASE 6

Oryzabase Gene Symbol Synonym(s)

OsAPx6, OsAPx06, OSAPX6, APx6

Oryzabase Gene Name Synonym(s)

ascorbate peroxidase 6

Transcript Evidence

AK061107 (DDBJ, Best hit)

AK099201 (DDBJ, Best hit)

Protein Evidence

Q9XPR6 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: response to oxidative stress (GO:0006979)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: peroxidase activity (GO:0004601)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Haem peroxidase, plant/fungal/bacterial (IPR002016)

Plant ascorbate peroxidase (IPR002207)

Haem peroxidase (IPR010255)

Peroxidases heam-ligand binding site (IPR019793)

Full-length cDNA

006-207-B12 (Online Clone Ordering)

J023122P03 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0178100-01)

Others

Oryzabase (8956)

Transcript

1302 bp

>Os12t0178100-01 Haem peroxidase family protein.
GACCACGGAGCAGCGAACCACTCCCAAAACGCCACCAAAACCCTCCTCTCCCCACCTCCG
CCGCCGCCGACATGGCCGTCGTCCACCGCCTCCTCCGCCGCGGCCTCTCCGCCGCCTCTC
CCCTCCCCTCTCTTCAGGAGCTCGGGAGGCGTCCGGCGAGCTCGTCGGCGGCGGCGGCGG
GGGACGCGGCGGCTGAGCTGCGGGGCGCGCGGGAGGACGTCAAGCAGCTGCTCAAGTCCA
CCTCCTGCCATCCCATCCTGGTTCGGTTAGGGTGGCATGATGCTGGTACTTATGACAAGA
ACATTACTGAATGGCCAAAGTGTGGTGGTGCCAATGGTAGCTTGAGATTCGAAATTGAGT
TAAAACATGCGGCTAATGCAGGTCTTGTGAATGCTTTGAAGCTGATCCAGCCCATCAAAG
ACAAGCATGCAGGTGTCACTTATGCAGATCTGTTTCAGCTCGCCAGTGCTACAGCCATTG
AGGAAGCCGGTGGCCCCAAGATCCCCATGATCTATGGAAGGGTTGATGTTGCTGCCCCTG
AACAATGCCCGCCAGAGGGGAGACTTCCTGCTGCTGGCCCTCCTTCACCTGCGGAACATC
TACGAGAAGTATTCTATAGAATGGGCCTGAGTGACAAGGAAATTGTTGCATTGTCAGGAG
CTCATACACTTGGACGATCTAGACCAGAGCGCAGTGGATGGGGCAAACCAGAAACTAAAT
ACACTAAAAACGGACCTGGTGCACCTGGAGGGCAATCTTGGACATCACAGTGGCTGAAGT
TTGATAATAGCTACTTCAAGGACATCAAAGAACGCCGAGATGAGGACCTTCTAGTTCTGC
CTACTGATGCTGTGCTCTTTGAGGACTCATCATTCAAGATCTATGCTGAAAAGTACGCCG
CAGATCAGGATGCATTTTTTGAAGACTATGCTGAAGCTCATGCCAAACTGAGCAATCTCG
GAGCAAAGTTTGATCCTCCAAAGGGTATTTCACTGGAATAAGTGGCGTCTGCTGCCGATG
AGCTGCATTTTGGCGAATGAACAAGACGATACCCTGTTTCTTCTTGCTACTATAGAGCAT
ATTATGGTTTTATTACCGATCCAGAAATTTAATCCATTGATCGGCAAATGTGATGTTGGT
GTTTTGTATTGAGTTGTGCTCTCCATTAGAAATAAAAATAGCGGTGGCCATTTTCGTTTC
CAGGACCAAACATTTTGGCACATTACAATACAATGTTTTAGATGATGTCTGCATTGAGCT
CTTACACAGGATGATCAAAATATATGACATAATTTATTACTG

CDS

930 bp

>Os12t0178100-01 Haem peroxidase family protein.
ATGGCCGTCGTCCACCGCCTCCTCCGCCGCGGCCTCTCCGCCGCCTCTCCCCTCCCCTCT
CTTCAGGAGCTCGGGAGGCGTCCGGCGAGCTCGTCGGCGGCGGCGGCGGGGGACGCGGCG
GCTGAGCTGCGGGGCGCGCGGGAGGACGTCAAGCAGCTGCTCAAGTCCACCTCCTGCCAT
CCCATCCTGGTTCGGTTAGGGTGGCATGATGCTGGTACTTATGACAAGAACATTACTGAA
TGGCCAAAGTGTGGTGGTGCCAATGGTAGCTTGAGATTCGAAATTGAGTTAAAACATGCG
GCTAATGCAGGTCTTGTGAATGCTTTGAAGCTGATCCAGCCCATCAAAGACAAGCATGCA
GGTGTCACTTATGCAGATCTGTTTCAGCTCGCCAGTGCTACAGCCATTGAGGAAGCCGGT
GGCCCCAAGATCCCCATGATCTATGGAAGGGTTGATGTTGCTGCCCCTGAACAATGCCCG
CCAGAGGGGAGACTTCCTGCTGCTGGCCCTCCTTCACCTGCGGAACATCTACGAGAAGTA
TTCTATAGAATGGGCCTGAGTGACAAGGAAATTGTTGCATTGTCAGGAGCTCATACACTT
GGACGATCTAGACCAGAGCGCAGTGGATGGGGCAAACCAGAAACTAAATACACTAAAAAC
GGACCTGGTGCACCTGGAGGGCAATCTTGGACATCACAGTGGCTGAAGTTTGATAATAGC
TACTTCAAGGACATCAAAGAACGCCGAGATGAGGACCTTCTAGTTCTGCCTACTGATGCT
GTGCTCTTTGAGGACTCATCATTCAAGATCTATGCTGAAAAGTACGCCGCAGATCAGGAT
GCATTTTTTGAAGACTATGCTGAAGCTCATGCCAAACTGAGCAATCTCGGAGCAAAGTTT
GATCCTCCAAAGGGTATTTCACTGGAATAA

Protein

309 aa

>Os12t0178100-01 Haem peroxidase family protein.
MAVVHRLLRRGLSAASPLPSLQELGRRPASSSAAAAGDAAAELRGAREDVKQLLKSTSCH
PILVRLGWHDAGTYDKNITEWPKCGGANGSLRFEIELKHAANAGLVNALKLIQPIKDKHA
GVTYADLFQLASATAIEEAGGPKIPMIYGRVDVAAPEQCPPEGRLPAAGPPSPAEHLREV
FYRMGLSDKEIVALSGAHTLGRSRPERSGWGKPETKYTKNGPGAPGGQSWTSQWLKFDNS
YFKDIKERRDEDLLVLPTDAVLFEDSSFKIYAEKYAADQDAFFEDYAEAHAKLSNLGAKF
DPPKGISLE*

5'UTR

chr12:3959735..3959805 (- strand) : 71 bp

CDS

chr12:3959669..3959734 (- strand) : 66 bp

chr12:3959416..3959538 (- strand) : 123 bp

chr12:3958949..3959069 (- strand) : 121 bp

chr12:3958776..3958876 (- strand) : 101 bp

chr12:3958586..3958673 (- strand) : 88 bp

chr12:3957489..3957556 (- strand) : 68 bp

chr12:3957321..3957407 (- strand) : 87 bp

chr12:3956746..3956820 (- strand) : 75 bp

chr12:3956582..3956659 (- strand) : 78 bp

chr12:3956381..3956485 (- strand) : 105 bp

chr12:3956282..3956299 (- strand) : 18 bp

3'UTR

chr12:3955981..3956281 (- strand) : 301 bp

FASTA

>Os12t0178100-01 class=Sequence position=chr12:3955981..3959805 (- strand)
GACCACGGAG CAGCGAACCA CTCCCAAAAC GCCACCAAAA CCCTCCTCTC CCCACCTCCG CCGCCGCCGA CATGGCCGTC
GTCCACCGCC TCCTCCGCCG CGGCCTCTCC GCCGCCTCTC CCCTCCCCTC TCTTCAGGTA CTAGTACCAC CTACGACGCC
TCCCCCCCTC CCTTTCGCTG TTCATTACCC GCGCCGGCGG CGGACCGGTT CTTGATTTAG CGATGTCCCT TTCTTGATGA
TTTTTGTTCA TTTTCTCCCC CGTGAAGGAG CTCGGGAGGC GTCCGGCGAG CTCGTCGGCG GCGGCGGCGG GGGACGCGGC
GGCTGAGCTG CGGGGCGCGC GGGAGGACGT CAAGCAGCTG CTCAAGTCCA CCTCCTGCCA TCCCATCCTG GTATGCTAAT
ATATGCTTTG CTGCTTTAGT GTTCTTGTGC AAAGATTGCG GGTTTGTATG GTTCGAAGAG TATAATGGGA TTTTAGATTG
TCTAGCTATA TCCATGGATT TCGCATCTCT ACAAAAGATT GTTCTTTGTG TGTTTAGTTA ACTGGTCGAT TATGCTATTT
AAAACAGTAA CTTTTACTTC GAGAAGATGC AACTGCTCTA GTTCACCTGT GTGCAAGAAG ACTGTAACAC GTTCTATGCA
CAATATTCGC TAGATTTGTG CAGTTCATGG TTCTGCATCT GCTTGATCGA ACATTGCATA TTTATGACTT GTCTGCTGGG
TTAACCTTGG TTGCAGGTTC GGTTAGGGTG GCATGATGCT GGTACTTATG ACAAGAACAT TACTGAATGG CCAAAGTGTG
GTGGTGCCAA TGGTAGCTTG AGATTCGAAA TTGAGTTAAA ACATGCGGCT AATGCAGGTA GTGCTTCTGT TCTGTCATTA
TCTATTGTTC GTGATTCATG GTTATCCTTA CAATAACCCT CTACTTCAGG TCTTGTGAAT GCTTTGAAGC TGATCCAGCC
CATCAAAGAC AAGCATGCAG GTGTCACTTA TGCAGATCTG TTTCAGCTCG CCAGTGCTAC AGCCATTGAG GTCCTTTTGT
CACTTTAGTC TAATGATAAC TATGAACTAT CATTCAAACA GTATTTATTA TTTAATGCTG ATATGATTGC TTTGGTCTGT
TTTAAAACTC AGGAAGCCGG TGGCCCCAAG ATCCCCATGA TCTATGGAAG GGTTGATGTT GCTGCCCCTG AACAATGCCC
GCCAGAGGGG AGACTTCCTG GTCAGTAGCT TTTGGGTTCT GTAGCCCAAA TTTGTTCGTT ACCGTGATTT ATCATCTGGA
AACTAAAATA TAATGCTGTA CCTTTAGTGT CATGTCACAC TGATCCCAAG TTGCTATTAC AATTGGCCAT CTTCTTGCAG
CTTCATTTCG CAAATTCTAC TTTCTCCTTA TTCATTAAAC CTAGAATATT GATAACTTTC AGAGCAGAAC TGATATGTGT
TCCAACACTC AGAAATGAAG TTACAAATAT ACTCTATTGG TCCTCTTGTT TAATCTCAAT TTATGGGTTA TCATGCAATT
GAGATACCTG ATTGACATAG GAAATCGCGC ATATCCATCT TTATTTGTCT GCAATCTATT TACATCAAAA TCAAATTATT
TAGATGTAGT GTCAACAATA GAAGACATTA ATATAAATTG ATAGTTTTCT TGCTAACCTA CTGTAATAGT CCTGTTTTAT
TTCTTCTTTA ATGATAAATT TATTTTCTTA AATGGACAAT GGTCTGCCTA TAATAGGCTA TTACATTCGT GGTAATGCCT
CTCAGATTCA ACTTATTTAG AAGGTTTAGG CGTGGTATCT TATCCATGTA TCTATGGGTT TTACTTCATG AAGTACTAAA
ATTGATGCTA ACTGGCTAAA AGCATGAAAA AACAAGTTTC TTATGAAATA TTGCCACCGT GAGCTCTGTA ATCTGGTGTA
ATAACATTTT GGACATGCAA ATGTGTAAGA AAGATTACCC CAATTGCAAT ATAACAGAAA AATTGTAAGC TGCACATGCT
GTGCAGAATG AAAATCAGTG CTATGATTGC ACTTAACCTG TGAGATTGAT AAAATATAGC TCCCCAAGAA TTGCAGCACT
TTCAGCTGTT TGTTTTTGTA TTCACATGAC ATTGATATAT TTCCTGCTGT GTCTTATAGT GTACTTTGAT ATTTGAAATC
TAGTGCTGAT GATGATCTAA TCCTCTTTCA TATGCATGTG CTTTCTGTTG CAATTTTGTT CCCTATATTT TACATTTCCA
CCCTTTCAGC TGCTGGCCCT CCTTCACCTG CGGAACATCT ACGAGAAGTA TTCTATAGAA TGGGCCTGAG TGACAAGGTA
CTTGCAGATT GCTTCATTCA ATATTCCAAA CAACTTTTTC TGGGGATTTG CTAGTTACAT CTGTTTTGTG ATCTGTAGGA
AATTGTTGCA TTGTCAGGAG CTCATACACT TGGACGATCT AGACCAGAGC GCAGTGGATG GGGCAAACCA GAAACTAAAT
ACACTGTATG TAACTTATAT AGTTATATCA GTAGTAGGTT ATTGTTCTGA TTTTAGTAAC GCCTTGTCCA TGATTCATTT
TGGAGTATTG CATGTTATTT AGTTACTACG TATTTTTTAG ATTAGCCAAT GGGATAATTA AGTTGTCATC ACTGGCAATG
CTTATTGATC TTGCATATAT CTCTTCCTTG TAAAAGCTCT GTATTGAAGA TCTTTATATG ATTTATTACT ACTTCACCGA
AGAAAATAAA GAGATGCTTC TGCGCTGTTG TGTTAGTTGA CCATATTATG CTTCATCTCT AATCGCGGAT GACCTATATT
AGCATCAATG CTACAAACTT TCCTACTACA GTGCTTATAT GCTTTCAAAT ATGTTCTTGT GGGTAGTAGA CTTGCAGTAT
TAACTATATC TAGCATGCAC TCCTTCATGA AGTTCTTGCT GATGAATGTT CTGAATGTTG AATTTCTTGT TTGGCTAATT
GATTAATTTC TTTTGACTCG CAAAGAAAAA CGGACCTGGT GCACCTGGAG GGCAATCTTG GACATCACAG TGGCTGAAGT
TTGATAATAG CTACTTCAAG GTAGGATGCA CTATTTTCTT TATCAATACC AAACATGATA GCAGTTACAA TTTACAAAAC
TTATGTTAGT CTGCATAAAA TTTAAGGACA TCAAAGAACG CCGAGATGAG GACCTTCTAG TTCTGCCTAC TGATGCTGTG
CTCTTTGAGG ACTCATCATT CAAGGTTAGT GAAGATTCTC ATCAGCTCTT GTTGTAAAGA ACTGCAAATC AAAAGTGACG
CTCTAAACTA AAAAGTTTTG CTTGCTTGCC ATGCCTGAAG ATCTATGCTG AAAAGTACGC CGCAGATCAG GATGCATTTT
TTGAAGACTA TGCTGAAGCT CATGCCAAAC TGAGCAATCT CGGAGCAAAG TTTGATCCTC CAAAGGTAAG TGAGATTAAA
GACTAACATT ACTGGAATTA AAAAATGTGC AGTCAACTTG ACATGGTTAT CACTGAAATG ACACAGGGTA TTTCACTGGA
ATAAGTGGCG TCTGCTGCCG ATGAGCTGCA TTTTGGCGAA TGAACAAGAC GATACCCTGT TTCTTCTTGC TACTATAGAG
CATATTATGG TTTTATTACC GATCCAGAAA TTTAATCCAT TGATCGGCAA ATGTGATGTT GGTGTTTTGT ATTGAGTTGT
GCTCTCCATT AGAAATAAAA ATAGCGGTGG CCATTTTCGT TTCCAGGACC AAACATTTTG GCACATTACA ATACAATGTT
TTAGATGATG TCTGCATTGA GCTCTTACAC AGGATGATCA AAATATATGA CATAATTTAT TACTG

Locus: Os12g0178100

Loading...

Locus: Os12g0178100

Loading...