Os12t0181500-01

Locus

Os12g0181500

Description

Amino acid permease, Transport of amino acids

RAP-DB Gene Symbol Synonym(s)

OsAAP11A, AAP11A, OsAAP16, AAP16

RAP-DB Gene Name Synonym(s)

amino acid permease 11A, amino acid permease 16, amino acid/auxin permease 16

CGSNL Gene Symbol

AAP11A

CGSNL Gene Name

AMINO ACID PERMEASE 11A

Oryzabase Gene Symbol Synonym(s)

OsAAP11A, OsAAP16, AAP16

Oryzabase Gene Name Synonym(s)

amino acid permease 11A, amino acid permease 16, amino acid/auxin permease 16

Transcript Evidence

AK061448

AK099164

AK106090

Protein Evidence

Q2QWV5

Literature

PMID: 25907566

PMID: 23166615

Note

Manual Curation

September 3, 2015

Functional domain (InterPro)

Amino acid transporter, transmembrane domain (IPR013057)

Full-length cDNA

006-307-E03 (Online Clone Ordering)

J023073O03 (Online Clone Ordering)

001-207-B07 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0181500-01)

RiceXPro (AK099164)

Others

Oryzabase (18500)

KEGG (Os12t0181500-01)

Transcript

1708 bp

>Os12t0181500-01 Amino acid permease, Transport of amino acids
ACAAACACTCGAGCTCACACCTGCTCGATCAAAATCCTCCAACAACTCGATCCATTCGCA
GTAGCTGCGAGCTCTGAGCGGCGGCGAGGTGTCCGACATGGCGTCGGGGCAGAAGGTggt
gaagccgatggaggtgtcggtggaggccgggaacgccggggaggcggcgtggctggacga
cgacgggcgggcgcggcggacgggcacgttctggacggcgagcgcgcacatcatcaccgc
cgtcatcggctccggcgtgctgtcgctggcgtgggcGATCGCGCAGCTGGGCTGGGTGGC
CGGTCCCGCCGTGATGCTCCTCTTCGCCTTCGTCATCTACTACACCTCCACCCTCCTCGC
CGAGTGCTACCGCACCGGCGACCCGGCCACCGGCAAGCGAAACTACACCTACATGGACGC
CGTGCGCGCCAACCTCGGCGGCGCCAAGGTCACCTTCTGCGGCGTCATCCAGTACGCCAA
CCTCGTCGGCGTCGCCATCGGCTACACCATCGCGTCGTCCATCAGCATGCGCGCCATCAG
GAGGGCCGGCTGCTTCCACCACAACGGCCATGGTGACCCGTGCCGCAGCTCCAGCAACCC
TTACATGATCCTCTTCGGCGTCGTGCAGATCGTCTTCTCGCAGATCCCGGACTTCGACCA
GATTTGGTGGCTGTCCATCGTCGCCGCCGTCATGTCCTTCACCTACTCCGGCATCGGCCT
CTCCCTCGGCATCGTCCAGACAATCTCCAATGGCGGGATCCAGGGCAGCCTCACCGGAAT
CAGCATCGGCGTCGGCGTCAGCTCAACGCAGAAGGTGTGGCGCAGCCTGCAGGCATTCGG
CGACATCGCCTTCGCATACTCCTTCTCCAACATCCTCATCGAGATCCAAGACACGATCAA
GGCGCCGCCGCCGTCGGAGGCGAAGGTGATGAAGAGCGCGACGAGGCTGAGCGTGGCGAC
GACCACGGTGTTCTACATGCTGTGCGGGTGCATGGGCTACGCGGCGTTCGGCGACGCGGC
GCCCGACAACCTCCTCACGGGCTTCGGCTTCTAcgagcccttctggctgctcgacgtcgc
caacgtcgccatcgtcgtgcacctcgtcggcgcctaccaggtgttcgtccagccaatctt
cgccttcgtcgagcgctgggcctcccgccggtggccggacagcgcgttcatcgccaagga
gctccgcgtggggcccttcgcgctcagcctcttccgcctgacgtggcgctcggcgttcgt
ctgcctcaccacagtcgtcgccatgctcctccccttcttcggcaacgtggtgggtctcct
cggcgccgtctccttctggccgctcaccgtctacttccccgtcgagatgtacatcgcgca
gcgcggcgtgccacgtggcagcgcgaggtgggtctcgctcaagacgctcagcgcgtgctg
cctcgtcgtctccatcgccgccgctgcgggctccattgctgacgtcatcgacgctctcAA
GGTGTACAGACCGTTCAGCGGATGATTGGAACGTGAGGGGCACGTGTGCTCGTTAAATTA
TTTCTtactatctctgtaccaaaatatagcaaactagtataaataggacgaaattcgggt
agttctcaggtacgaattcatcgtactaggaaatatctcacattgtattaagttgctata
ttttgggTCAGCATTAGTACAATATTAC

CDS

1428 bp

>Os12t0181500-01 Amino acid permease, Transport of amino acids
ATGGCGTCGGGGCAGAAGGTggtgaagccgatggaggtgtcggtggaggccgggaacgcc
ggggaggcggcgtggctggacgacgacgggcgggcgcggcggacgggcacgttctggacg
gcgagcgcgcacatcatcaccgccgtcatcggctccggcgtgctgtcgctggcgtgggcG
ATCGCGCAGCTGGGCTGGGTGGCCGGTCCCGCCGTGATGCTCCTCTTCGCCTTCGTCATC
TACTACACCTCCACCCTCCTCGCCGAGTGCTACCGCACCGGCGACCCGGCCACCGGCAAG
CGAAACTACACCTACATGGACGCCGTGCGCGCCAACCTCGGCGGCGCCAAGGTCACCTTC
TGCGGCGTCATCCAGTACGCCAACCTCGTCGGCGTCGCCATCGGCTACACCATCGCGTCG
TCCATCAGCATGCGCGCCATCAGGAGGGCCGGCTGCTTCCACCACAACGGCCATGGTGAC
CCGTGCCGCAGCTCCAGCAACCCTTACATGATCCTCTTCGGCGTCGTGCAGATCGTCTTC
TCGCAGATCCCGGACTTCGACCAGATTTGGTGGCTGTCCATCGTCGCCGCCGTCATGTCC
TTCACCTACTCCGGCATCGGCCTCTCCCTCGGCATCGTCCAGACAATCTCCAATGGCGGG
ATCCAGGGCAGCCTCACCGGAATCAGCATCGGCGTCGGCGTCAGCTCAACGCAGAAGGTG
TGGCGCAGCCTGCAGGCATTCGGCGACATCGCCTTCGCATACTCCTTCTCCAACATCCTC
ATCGAGATCCAAGACACGATCAAGGCGCCGCCGCCGTCGGAGGCGAAGGTGATGAAGAGC
GCGACGAGGCTGAGCGTGGCGACGACCACGGTGTTCTACATGCTGTGCGGGTGCATGGGC
TACGCGGCGTTCGGCGACGCGGCGCCCGACAACCTCCTCACGGGCTTCGGCTTCTAcgag
cccttctggctgctcgacgtcgccaacgtcgccatcgtcgtgcacctcgtcggcgcctac
caggtgttcgtccagccaatcttcgccttcgtcgagcgctgggcctcccgccggtggccg
gacagcgcgttcatcgccaaggagctccgcgtggggcccttcgcgctcagcctcttccgc
ctgacgtggcgctcggcgttcgtctgcctcaccacagtcgtcgccatgctcctccccttc
ttcggcaacgtggtgggtctcctcggcgccgtctccttctggccgctcaccgtctacttc
cccgtcgagatgtacatcgcgcagcgcggcgtgccacgtggcagcgcgaggtgggtctcg
ctcaagacgctcagcgcgtgctgcctcgtcgtctccatcgccgccgctgcgggctccatt
gctgacgtcatcgacgctctcAAGGTGTACAGACCGTTCAGCGGATGA

Protein

475 aa

>Os12t0181500-01 Amino acid permease, Transport of amino acids
MASGQKVVKPMEVSVEAGNAGEAAWLDDDGRARRTGTFWTASAHIITAVIGSGVLSLAWA
IAQLGWVAGPAVMLLFAFVIYYTSTLLAECYRTGDPATGKRNYTYMDAVRANLGGAKVTF
CGVIQYANLVGVAIGYTIASSISMRAIRRAGCFHHNGHGDPCRSSSNPYMILFGVVQIVF
SQIPDFDQIWWLSIVAAVMSFTYSGIGLSLGIVQTISNGGIQGSLTGISIGVGVSSTQKV
WRSLQAFGDIAFAYSFSNILIEIQDTIKAPPPSEAKVMKSATRLSVATTTVFYMLCGCMG
YAAFGDAAPDNLLTGFGFYEPFWLLDVANVAIVVHLVGAYQVFVQPIFAFVERWASRRWP
DSAFIAKELRVGPFALSLFRLTWRSAFVCLTTVVAMLLPFFGNVVGLLGAVSFWPLTVYF
PVEMYIAQRGVPRGSARWVSLKTLSACCLVVSIAAAAGSIADVIDALKVYRPFSG*

5'UTR

chr12:4120926..4121022 (+ strand) : 97 bp

CDS

chr12:4121023..4121671 (+ strand) : 649 bp

chr12:4121776..4121918 (+ strand) : 143 bp

chr12:4122018..4122653 (+ strand) : 636 bp

3'UTR

chr12:4122654..4122836 (+ strand) : 183 bp

FASTA

>Os12t0181500-01 class=Sequence position=chr12:4120926..4122836 (+ strand)
ACAAACACTC GAGCTCACAC CTGCTCGATC AAAATCCTCC AACAACTCGA TCCATTCGCA GTAGCTGCGA GCTCTGAGCG
GCGGCGAGGT GTCCGACATG GCGTCGGGGC AGAAGGTggt gaagccgatg gaggtgtcgg tggaggccgg gaacgccggg
gaggcggcgt ggctggacga cgacgggcgg gcgcggcgga cgggcacgtt ctggacggcg agcgcgcaca tcatcaccgc
cgtcatcggc tccggcgtgc tgtcgctggc gtgggcGATC GCGCAGCTGG GCTGGGTGGC CGGTCCCGCC GTGATGCTCC
TCTTCGCCTT CGTCATCTAC TACACCTCCA CCCTCCTCGC CGAGTGCTAC CGCACCGGCG ACCCGGCCAC CGGCAAGCGA
AACTACACCT ACATGGACGC CGTGCGCGCC AACCTCGGCG GCGCCAAGGT CACCTTCTGC GGCGTCATCC AGTACGCCAA
CCTCGTCGGC GTCGCCATCG GCTACACCAT CGCGTCGTCC ATCAGCATGC GCGCCATCAG GAGGGCCGGC TGCTTCCACC
ACAACGGCCA TGGTGACCCG TGCCGCAGCT CCAGCAACCC TTACATGATC CTCTTCGGCG TCGTGCAGAT CGTCTTCTCG
CAGATCCCGG ACTTCGACCA GATTTGGTGG CTGTCCATCG TCGCCGCCGT CATGTCCTTC ACCTACTCCG GCATCGGCCT
CTCCCTCGGC ATCGTCCAGA CAATCTGTAC GTCCATTAAT TCTTCTGTCA CATACAGATA ATCTAGTTCT TTAATTTGTC
TTTGCTGCTC GAGATGCATA TGCTGACCGT GATGAGCTGT GAATTTGCAG CCAATGGCGG GATCCAGGGC AGCCTCACCG
GAATCAGCAT CGGCGTCGGC GTCAGCTCAA CGCAGAAGGT GTGGCGCAGC CTGCAGGCAT TCGGCGACAT CGCCTTCGCA
TACTCCTTCT CCAACATCCT CATCGAGATC CAAGTGAGTG AGACTCACTA CAAAGTTAAT TTGCTCTGTT TGAACGAACA
AGGTTAATTT GCTCATCGAT CGCTGCTTGC TCTGTTTTGT TTTGTTGTTC AGGACACGAT CAAGGCGCCG CCGCCGTCGG
AGGCGAAGGT GATGAAGAGC GCGACGAGGC TGAGCGTGGC GACGACCACG GTGTTCTACA TGCTGTGCGG GTGCATGGGC
TACGCGGCGT TCGGCGACGC GGCGCCCGAC AACCTCCTCA CGGGCTTCGG CTTCTAcgag cccttctggc tgctcgacgt
cgccaacgtc gccatcgtcg tgcacctcgt cggcgcctac caggtgttcg tccagccaat cttcgccttc gtcgagcgct
gggcctcccg ccggtggccg gacagcgcgt tcatcgccaa ggagctccgc gtggggccct tcgcgctcag cctcttccgc
ctgacgtggc gctcggcgtt cgtctgcctc accacagtcg tcgccatgct cctccccttc ttcggcaacg tggtgggtct
cctcggcgcc gtctccttct ggccgctcac cgtctacttc cccgtcgaga tgtacatcgc gcagcgcggc gtgccacgtg
gcagcgcgag gtgggtctcg ctcaagacgc tcagcgcgtg ctgcctcgtc gtctccatcg ccgccgctgc gggctccatt
gctgacgtca tcgacgctct cAAGGTGTAC AGACCGTTCA GCGGATGATT GGAACGTGAG GGGCACGTGT GCTCGTTAAA
TTATTTCTta ctatctctgt accaaaatat agcaaactag tataaatagg acgaaattcg ggtagttctc aggtacgaat
tcatcgtact aggaaatatc tcacattgta ttaagttgct atattttggg TCAGCATTAG TACAATATTA C

Locus: Os12g0181500

Loading...

Locus: Os12g0181500

Loading...