Os12t0182300-01

Locus

Os12g0182300

Description

Receptor-like protein kinase, Negative regulation of salt-stress response, Regulation of programmed cell death and disease resistance response

RAP-DB Gene Symbol Synonym(s)

SPL36

RAP-DB Gene Name Synonym(s)

spotted leaf 36

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK067635

Protein Evidence

Q2QWU6

Literature

PMID: 33825994

Note

Manual Curation

April 12, 2021

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein binding (GO:0005515)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Leucine-rich repeat domain superfamily (IPR032675)

Protein kinase-like domain superfamily (IPR011009)

Leucine-rich repeat-containing N-terminal, plant-type (IPR013210)

Protein kinase domain (IPR000719)

Serine-threonine/tyrosine-protein kinase, catalytic domain (IPR001245)

Leucine-rich repeat, typical subtype (IPR003591)

Leucine-rich repeat (IPR001611)

Experimentally confirmed subcellular location

plasma membrane (GO:0005886)

cytoplasm (GO:0005737)

Full-length cDNA

J013110A16 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0182300-01)

RiceXPro (AK067635)

Others

KEGG (Os12t0182300-01)

Transcript

3607 bp

>Os12t0182300-01 Receptor-like protein kinase, Negative regulation of salt-stress response, Regulation of programmed cell death and disease resistance response
ACTGGGAGTCTGGGAGGAGCAAGAAGAGGAGAGAAGAGAGCCATGGCCAAGAACACCGAG
AGCCCCAAAACCTAGGGAAAGAGAGGAAAAAATCGATTTTCTTGGGTGGTGGTTGAGCCT
GCAGTGAAGTTCATCAGGGAGGAAAGGGAGGGGATTAAGGGAAGGAGATACAGGAATCAA
TGGGAGGCCAAGAACAGGTGGCCATGGCGGAGAGGAGGCCTTGTTACTGTCGCAACAATG
GCTTCTTGCTGCTGCTGGTACAAGTTCTCCTCTTCTTGTTCTTGTTTCTTGATTCGTCCA
TGGTCGCCACTGCCGCGTCGGCGCCGGCACCGCTAAATACGACTCAGGTATCGATCATGA
AGGAGCTTTCTGGCTTGGTTACTGCCAGTGCCAAGTGGAACACGAGCGATTCGAATCCAT
GCCGATGGGATGGAGTGAGTTGCTCTTCTAGCTCCAATTCCATATCAGTTGTGACCAACC
TTACTTTGTCTGGGTATGGTTTGTCCAACTCCACCATATTTGCAACCATATGCTCTCTTG
ACACCTTGCAAATCCTTGATCTCTCTAAGAATTCCTTCACCAATTCGATAGAGCAATTCT
TCACCTCTTCTTGCTCCATGAAGGCTGGATTGCGGTCACTTAATCTCAGCAGCAGCCAGC
TATCCATGCCTCTTAGTAATTTCTCTGGTTTTCCCCTTCTTGAGGTTCTTGACTTGTCCT
TCAATTCTTTCAGTGGTGATGTCAGAACCCAGTTGAGTTCTTTGCTCAAGCTGAGAAGCT
TGAATCTTAGTAGCAATAACTTGGCTGGTGATGTTCCTACAAGCATGACCCCGTCTTTGG
AGGAATTGGTGTTGTCCATCAACAATTTCAGTGGTAGCATTCCAATAGCTTTGTTCAATT
ACCAAAATCTTACTATGCTGGATCTTAGTCAGAACAATCTAAATGGTGATGTACCGGATG
AGTTCTTAAAGTTACCCAAGCTCAAGACTTTGCTCTTATCAGGTAATCAACTGAGTGGCA
ATATACCTGTGAGTGTGTCAAATGTTGCAAGCCTTGCTCGGTTTGCAGCTAATCAGAACA
ATTTTACCGGTTTCATCCCTAGTGGTATCACCAAGAATGTGAAGATGCTGGATCTGAGTT
ACAACGAACTTAGTGGAGTGATTCCCTCTGATATTCTTAGTCCTGTGGGACTGTGGACTG
TTGATCTCACTCACAATAAGCTCGAAGGGCCCATCCCTAGCAGCTTGTCTCCGACCCTCT
ATCGGTTGAGGCTTGGTGGAGGCAACTCTCTCAATGGAACCATCCCGGCCACCATTGGTG
ATGCATCGACCTTGGCTTATCTTGAGCTGGATAGCAATCAGTTGACGGGAAGCATACCAT
TGGAACTTGGCAGATGCAAGAGTTTGTCTTTGCTGAATCTGGCATCAAATAAGTTTCAGG
GTCCAGTGCCTGATGCAATCAGCAGCCTTGACAAACTGGTAGTTCTTAAACTCCAAATGA
ACAATCTGGATGGACCTATCCCAAGTGTATTTTCTAATTTGACAAGCCTGATCACATTGA
ATCTTAGTGGTAATTCATTCACTGGAGGGATACCAAGAGAAATCGGCAAGCTGCCAAAGC
TTTCCATTTTGAATTTGCAATGCAACAAGATCAGCGGCACCATTCCAGATTCACTCCATT
TATTAACTTCTCTAATTGAGCTCAATCTGGGGAATAATATCTTGACTGGTACCATCCCAA
CAATGCCGACCAAATTGAGTACTGTTCTTAATCTAAGCCACAACAATCTCAGCGGATCTA
TTCCTTCAAATATTGACTTATTGAGTGATCTAGAGATTCTTGATCTTTCATACAACAACT
TGTATGGTGAGGTGCCGGCCTCACTTGCAAAGCTAGAAAGCTTGACGCAACTAGTGCTTT
CTTATAATCACCTTTCTGGGTCCATTCCTATATTTCGTCAACATGTTGATATTGCTACCA
ATGGAAATCCCGATCTTACAAATGGTACAAGAAATTATGACAACGCCCCTACAAGTGGTA
AGAGAAGGACACACAATACAGTCATCATCGTCGTTGCCATTACTGGTGCTCTTGTTGGAT
TGTGCTTGCTTGCTGCTATTGTTACAATTTCATATTCTAAGAGAATTTATCGTGTTGAAG
ATGAAGGACCATCAACTGAGGATGTTGCTCGAATCATCAATGGTCACCTCATAACTATGA
ATAGTATCCATACCTCTGCAATTGATTTCGTGAAAGCAATGGAAGCAGTCTCCAATCACA
GCAACATTTTTCTGAAAACAAGGTTCTGCACTTACTATAAGGCTGTGATGCCTAATGGCT
CAACCTATTCTTTAAAACAGATTAATTGTAGTGACAAGATATTCCAAATTGGGAGCCAAG
GGAAGGTTGCTCATGAACTTGAGGTACTTGGGAAGTTGAGCAATTCCAATGTAATGGTGC
CATTGGCTTATGTGTTGACAGAAGACAATGCATACATCATCTATGAGCATGTGCACAAGG
GCACGGTGTTCGATTTCCTTCATGCTGGAAGATCAGATGTTCTGGACTGGCCTTCACGGT
ATAGCATAGCTTTTGGGCTAGCCCAAGGGCTGACATTTCTTCATGGGTGCACTCAGCCAG
TTCTGCTTCTTGATCTGTCAACAAGGACTGTCCACTTGAAGTCAATGAATGAGCCTCAGA
TTGGAGATGTTGAACTTTACAAAATTGTTGATACTTTGAAGAGCAGTGGGAGCCTTTCGA
CCATTGCTGGTACAGTTGGTTATATTCCACCAGAGTATGCATACACGATGAGGTTGACGA
TGGCTGGCAACGTTTACAGCTTTGGAGTAATCTTACTGGAGCTTTTGACTGGGAAACCAT
CGGTCAGTGATGGCATCGAGTTAGCCAAGTGGGCTCTGAGTCTTTCAGGCAGCCCTGATC
AGAGGGAGCAGATCCTTGACACCAGGGTCTCAAGAACTTCAGCTGCTGTTCACAGCCAGA
TGTTGTCGGTCCTGAACATCGCCCTCGCTTGTGTTGCGCTCTCTCCAGATGCTCGACCAA
AGATGCGCACCGTCTTGAGGATGCTATTCAACGCAAAGTGATCTGGCATGATATGTTTTG
GTAGCTTAGGTAGGTTCTGAATGGAGTTTGATCATTTTGCTTAGTTTGTGGATGTCAGCA
ATCAGTATACGGGGTCCTTGTATAGTACCAGCACCATAGTTCAAGGTAGAGTAGTAGATT
ATGATATGGCTGATCAATTTAGTATTCAGATATCTATTTTGGAATGAATGACCAATGGGT
TTATCTATGCTGTATCATCATATATTCACACATGGTTATTAGCATACCTTGTACACGGCA
ATTCCATATAACAATAGTAGTGAAATAGAGCCATAGTTAAGGTAGAACAGTAGATAGACT
ATGATATATATCCCTGAACAATTTAGAAGCCAGATATCTGTTTTGGAATGAATCAGGAAT
TGTGTTCTTCTATGCTATATGATCATATTTGTAAATGGTTGGTTGTGTACATCCATGTGG
GATGTCGAGGCCGGATTGGCATCCATTATCTAACAAACATATATATAAATTGTTATTACT
TATTAGC

CDS

2922 bp

>Os12t0182300-01 Receptor-like protein kinase, Negative regulation of salt-stress response, Regulation of programmed cell death and disease resistance response
ATGGGAGGCCAAGAACAGGTGGCCATGGCGGAGAGGAGGCCTTGTTACTGTCGCAACAAT
GGCTTCTTGCTGCTGCTGGTACAAGTTCTCCTCTTCTTGTTCTTGTTTCTTGATTCGTCC
ATGGTCGCCACTGCCGCGTCGGCGCCGGCACCGCTAAATACGACTCAGGTATCGATCATG
AAGGAGCTTTCTGGCTTGGTTACTGCCAGTGCCAAGTGGAACACGAGCGATTCGAATCCA
TGCCGATGGGATGGAGTGAGTTGCTCTTCTAGCTCCAATTCCATATCAGTTGTGACCAAC
CTTACTTTGTCTGGGTATGGTTTGTCCAACTCCACCATATTTGCAACCATATGCTCTCTT
GACACCTTGCAAATCCTTGATCTCTCTAAGAATTCCTTCACCAATTCGATAGAGCAATTC
TTCACCTCTTCTTGCTCCATGAAGGCTGGATTGCGGTCACTTAATCTCAGCAGCAGCCAG
CTATCCATGCCTCTTAGTAATTTCTCTGGTTTTCCCCTTCTTGAGGTTCTTGACTTGTCC
TTCAATTCTTTCAGTGGTGATGTCAGAACCCAGTTGAGTTCTTTGCTCAAGCTGAGAAGC
TTGAATCTTAGTAGCAATAACTTGGCTGGTGATGTTCCTACAAGCATGACCCCGTCTTTG
GAGGAATTGGTGTTGTCCATCAACAATTTCAGTGGTAGCATTCCAATAGCTTTGTTCAAT
TACCAAAATCTTACTATGCTGGATCTTAGTCAGAACAATCTAAATGGTGATGTACCGGAT
GAGTTCTTAAAGTTACCCAAGCTCAAGACTTTGCTCTTATCAGGTAATCAACTGAGTGGC
AATATACCTGTGAGTGTGTCAAATGTTGCAAGCCTTGCTCGGTTTGCAGCTAATCAGAAC
AATTTTACCGGTTTCATCCCTAGTGGTATCACCAAGAATGTGAAGATGCTGGATCTGAGT
TACAACGAACTTAGTGGAGTGATTCCCTCTGATATTCTTAGTCCTGTGGGACTGTGGACT
GTTGATCTCACTCACAATAAGCTCGAAGGGCCCATCCCTAGCAGCTTGTCTCCGACCCTC
TATCGGTTGAGGCTTGGTGGAGGCAACTCTCTCAATGGAACCATCCCGGCCACCATTGGT
GATGCATCGACCTTGGCTTATCTTGAGCTGGATAGCAATCAGTTGACGGGAAGCATACCA
TTGGAACTTGGCAGATGCAAGAGTTTGTCTTTGCTGAATCTGGCATCAAATAAGTTTCAG
GGTCCAGTGCCTGATGCAATCAGCAGCCTTGACAAACTGGTAGTTCTTAAACTCCAAATG
AACAATCTGGATGGACCTATCCCAAGTGTATTTTCTAATTTGACAAGCCTGATCACATTG
AATCTTAGTGGTAATTCATTCACTGGAGGGATACCAAGAGAAATCGGCAAGCTGCCAAAG
CTTTCCATTTTGAATTTGCAATGCAACAAGATCAGCGGCACCATTCCAGATTCACTCCAT
TTATTAACTTCTCTAATTGAGCTCAATCTGGGGAATAATATCTTGACTGGTACCATCCCA
ACAATGCCGACCAAATTGAGTACTGTTCTTAATCTAAGCCACAACAATCTCAGCGGATCT
ATTCCTTCAAATATTGACTTATTGAGTGATCTAGAGATTCTTGATCTTTCATACAACAAC
TTGTATGGTGAGGTGCCGGCCTCACTTGCAAAGCTAGAAAGCTTGACGCAACTAGTGCTT
TCTTATAATCACCTTTCTGGGTCCATTCCTATATTTCGTCAACATGTTGATATTGCTACC
AATGGAAATCCCGATCTTACAAATGGTACAAGAAATTATGACAACGCCCCTACAAGTGGT
AAGAGAAGGACACACAATACAGTCATCATCGTCGTTGCCATTACTGGTGCTCTTGTTGGA
TTGTGCTTGCTTGCTGCTATTGTTACAATTTCATATTCTAAGAGAATTTATCGTGTTGAA
GATGAAGGACCATCAACTGAGGATGTTGCTCGAATCATCAATGGTCACCTCATAACTATG
AATAGTATCCATACCTCTGCAATTGATTTCGTGAAAGCAATGGAAGCAGTCTCCAATCAC
AGCAACATTTTTCTGAAAACAAGGTTCTGCACTTACTATAAGGCTGTGATGCCTAATGGC
TCAACCTATTCTTTAAAACAGATTAATTGTAGTGACAAGATATTCCAAATTGGGAGCCAA
GGGAAGGTTGCTCATGAACTTGAGGTACTTGGGAAGTTGAGCAATTCCAATGTAATGGTG
CCATTGGCTTATGTGTTGACAGAAGACAATGCATACATCATCTATGAGCATGTGCACAAG
GGCACGGTGTTCGATTTCCTTCATGCTGGAAGATCAGATGTTCTGGACTGGCCTTCACGG
TATAGCATAGCTTTTGGGCTAGCCCAAGGGCTGACATTTCTTCATGGGTGCACTCAGCCA
GTTCTGCTTCTTGATCTGTCAACAAGGACTGTCCACTTGAAGTCAATGAATGAGCCTCAG
ATTGGAGATGTTGAACTTTACAAAATTGTTGATACTTTGAAGAGCAGTGGGAGCCTTTCG
ACCATTGCTGGTACAGTTGGTTATATTCCACCAGAGTATGCATACACGATGAGGTTGACG
ATGGCTGGCAACGTTTACAGCTTTGGAGTAATCTTACTGGAGCTTTTGACTGGGAAACCA
TCGGTCAGTGATGGCATCGAGTTAGCCAAGTGGGCTCTGAGTCTTTCAGGCAGCCCTGAT
CAGAGGGAGCAGATCCTTGACACCAGGGTCTCAAGAACTTCAGCTGCTGTTCACAGCCAG
ATGTTGTCGGTCCTGAACATCGCCCTCGCTTGTGTTGCGCTCTCTCCAGATGCTCGACCA
AAGATGCGCACCGTCTTGAGGATGCTATTCAACGCAAAGTGA

Protein

974 aa

>Os12t0182300-01 Receptor-like protein kinase, Negative regulation of salt-stress response, Regulation of programmed cell death and disease resistance response
MGGQEQVAMAERRPCYCRNNGFLLLLVQVLLFLFLFLDSSMVATAASAPAPLNTTQVSIM
KELSGLVTASAKWNTSDSNPCRWDGVSCSSSSNSISVVTNLTLSGYGLSNSTIFATICSL
DTLQILDLSKNSFTNSIEQFFTSSCSMKAGLRSLNLSSSQLSMPLSNFSGFPLLEVLDLS
FNSFSGDVRTQLSSLLKLRSLNLSSNNLAGDVPTSMTPSLEELVLSINNFSGSIPIALFN
YQNLTMLDLSQNNLNGDVPDEFLKLPKLKTLLLSGNQLSGNIPVSVSNVASLARFAANQN
NFTGFIPSGITKNVKMLDLSYNELSGVIPSDILSPVGLWTVDLTHNKLEGPIPSSLSPTL
YRLRLGGGNSLNGTIPATIGDASTLAYLELDSNQLTGSIPLELGRCKSLSLLNLASNKFQ
GPVPDAISSLDKLVVLKLQMNNLDGPIPSVFSNLTSLITLNLSGNSFTGGIPREIGKLPK
LSILNLQCNKISGTIPDSLHLLTSLIELNLGNNILTGTIPTMPTKLSTVLNLSHNNLSGS
IPSNIDLLSDLEILDLSYNNLYGEVPASLAKLESLTQLVLSYNHLSGSIPIFRQHVDIAT
NGNPDLTNGTRNYDNAPTSGKRRTHNTVIIVVAITGALVGLCLLAAIVTISYSKRIYRVE
DEGPSTEDVARIINGHLITMNSIHTSAIDFVKAMEAVSNHSNIFLKTRFCTYYKAVMPNG
STYSLKQINCSDKIFQIGSQGKVAHELEVLGKLSNSNVMVPLAYVLTEDNAYIIYEHVHK
GTVFDFLHAGRSDVLDWPSRYSIAFGLAQGLTFLHGCTQPVLLLDLSTRTVHLKSMNEPQ
IGDVELYKIVDTLKSSGSLSTIAGTVGYIPPEYAYTMRLTMAGNVYSFGVILLELLTGKP
SVSDGIELAKWALSLSGSPDQREQILDTRVSRTSAAVHSQMLSVLNIALACVALSPDARP
KMRTVLRMLFNAK*

5'UTR

chr12:4182456..4182634 (- strand) : 179 bp

CDS

chr12:4179842..4182455 (- strand) : 2614 bp

chr12:4178921..4179228 (- strand) : 308 bp

3'UTR

chr12:4178415..4178920 (- strand) : 506 bp

FASTA

>Os12t0182300-01 class=Sequence position=chr12:4178415..4182634 (- strand)
ACTGGGAGTC TGGGAGGAGC AAGAAGAGGA GAGAAGAGAG CCATGGCCAA GAACACCGAG AGCCCCAAAA CCTAGGGAAA
GAGAGGAAAA AATCGATTTT CTTGGGTGGT GGTTGAGCCT GCAGTGAAGT TCATCAGGGA GGAAAGGGAG GGGATTAAGG
GAAGGAGATA CAGGAATCAA TGGGAGGCCA AGAACAGGTG GCCATGGCGG AGAGGAGGCC TTGTTACTGT CGCAACAATG
GCTTCTTGCT GCTGCTGGTA CAAGTTCTCC TCTTCTTGTT CTTGTTTCTT GATTCGTCCA TGGTCGCCAC TGCCGCGTCG
GCGCCGGCAC CGCTAAATAC GACTCAGGTA TCGATCATGA AGGAGCTTTC TGGCTTGGTT ACTGCCAGTG CCAAGTGGAA
CACGAGCGAT TCGAATCCAT GCCGATGGGA TGGAGTGAGT TGCTCTTCTA GCTCCAATTC CATATCAGTT GTGACCAACC
TTACTTTGTC TGGGTATGGT TTGTCCAACT CCACCATATT TGCAACCATA TGCTCTCTTG ACACCTTGCA AATCCTTGAT
CTCTCTAAGA ATTCCTTCAC CAATTCGATA GAGCAATTCT TCACCTCTTC TTGCTCCATG AAGGCTGGAT TGCGGTCACT
TAATCTCAGC AGCAGCCAGC TATCCATGCC TCTTAGTAAT TTCTCTGGTT TTCCCCTTCT TGAGGTTCTT GACTTGTCCT
TCAATTCTTT CAGTGGTGAT GTCAGAACCC AGTTGAGTTC TTTGCTCAAG CTGAGAAGCT TGAATCTTAG TAGCAATAAC
TTGGCTGGTG ATGTTCCTAC AAGCATGACC CCGTCTTTGG AGGAATTGGT GTTGTCCATC AACAATTTCA GTGGTAGCAT
TCCAATAGCT TTGTTCAATT ACCAAAATCT TACTATGCTG GATCTTAGTC AGAACAATCT AAATGGTGAT GTACCGGATG
AGTTCTTAAA GTTACCCAAG CTCAAGACTT TGCTCTTATC AGGTAATCAA CTGAGTGGCA ATATACCTGT GAGTGTGTCA
AATGTTGCAA GCCTTGCTCG GTTTGCAGCT AATCAGAACA ATTTTACCGG TTTCATCCCT AGTGGTATCA CCAAGAATGT
GAAGATGCTG GATCTGAGTT ACAACGAACT TAGTGGAGTG ATTCCCTCTG ATATTCTTAG TCCTGTGGGA CTGTGGACTG
TTGATCTCAC TCACAATAAG CTCGAAGGGC CCATCCCTAG CAGCTTGTCT CCGACCCTCT ATCGGTTGAG GCTTGGTGGA
GGCAACTCTC TCAATGGAAC CATCCCGGCC ACCATTGGTG ATGCATCGAC CTTGGCTTAT CTTGAGCTGG ATAGCAATCA
GTTGACGGGA AGCATACCAT TGGAACTTGG CAGATGCAAG AGTTTGTCTT TGCTGAATCT GGCATCAAAT AAGTTTCAGG
GTCCAGTGCC TGATGCAATC AGCAGCCTTG ACAAACTGGT AGTTCTTAAA CTCCAAATGA ACAATCTGGA TGGACCTATC
CCAAGTGTAT TTTCTAATTT GACAAGCCTG ATCACATTGA ATCTTAGTGG TAATTCATTC ACTGGAGGGA TACCAAGAGA
AATCGGCAAG CTGCCAAAGC TTTCCATTTT GAATTTGCAA TGCAACAAGA TCAGCGGCAC CATTCCAGAT TCACTCCATT
TATTAACTTC TCTAATTGAG CTCAATCTGG GGAATAATAT CTTGACTGGT ACCATCCCAA CAATGCCGAC CAAATTGAGT
ACTGTTCTTA ATCTAAGCCA CAACAATCTC AGCGGATCTA TTCCTTCAAA TATTGACTTA TTGAGTGATC TAGAGATTCT
TGATCTTTCA TACAACAACT TGTATGGTGA GGTGCCGGCC TCACTTGCAA AGCTAGAAAG CTTGACGCAA CTAGTGCTTT
CTTATAATCA CCTTTCTGGG TCCATTCCTA TATTTCGTCA ACATGTTGAT ATTGCTACCA ATGGAAATCC CGATCTTACA
AATGGTACAA GAAATTATGA CAACGCCCCT ACAAGTGGTA AGAGAAGGAC ACACAATACA GTCATCATCG TCGTTGCCAT
TACTGGTGCT CTTGTTGGAT TGTGCTTGCT TGCTGCTATT GTTACAATTT CATATTCTAA GAGAATTTAT CGTGTTGAAG
ATGAAGGACC ATCAACTGAG GATGTTGCTC GAATCATCAA TGGTCACCTC ATAACTATGA ATAGTATCCA TACCTCTGCA
ATTGATTTCG TGAAAGCAAT GGAAGCAGTC TCCAATCACA GCAACATTTT TCTGAAAACA AGGTTCTGCA CTTACTATAA
GGCTGTGATG CCTAATGGCT CAACCTATTC TTTAAAACAG ATTAATTGTA GTGACAAGAT ATTCCAAATT GGGAGCCAAG
GGAAGGTTGC TCATGAACTT GAGGTACTTG GGAAGTTGAG CAATTCCAAT GTAATGGTGC CATTGGCTTA TGTGTTGACA
GAAGACAATG CATACATCAT CTATGAGCAT GTGCACAAGG GCACGGTGTT CGATTTCCTT CATGCTGGAA GATCAGATGT
TCTGGACTGG CCTTCACGGT ATAGCATAGC TTTTGGGCTA GCCCAAGGGC TGACATTTCT TCATGGGTGC ACTCAGCCAG
TTCTGCTTCT TGATCTGTCA ACAAGGACTG TCCACTTGAA GTCAATGAAT GAGCCTCAGA TTGGAGATGT TGAACTTTAC
AAAATTGTTG ATACTTTGAA GAGCAGTGGG AGCCTTTCGA CCATTGCTGG TACAGTTGGT TATATTCCAC CAGGTAATGG
ACTGTTCTGG TTCAATTTGA GTGCATAATT ATCAACTTAA GCAGTTAAAC TGAAACTGCT GATAGTGGTT ATTTACTGTT
CTCTGTTGAT TTGATCTATT TATAGTTCAT ATCTATGTTT TCAAGTAATT TACTTGAGGC AATTCTGTTT GCATTACCTG
CATACTTCAA TTGACCACAA TCCTGTCTAC ACTCCTATGC TAGTTTTGTT TTCAGAATTT CTGGAGAAAA CATATTTGCT
TTGTTTCCCA TGGGTTGTCG TCTACTACAT TTGTAGTATC ATCCAAAAAA GGGGCTTtta actatttgcc actcttacgg
atgttgctta atgatttacc actaggccca catgtcatag acacatgaga gcccacatgt cattgacagg gtgtggcaaa
tcgttaactg ccatgtcaca aaagtggcaa atagttaaat ttccctccaa aataagcaca tctcctactt ttgacaaatc
taataaaaAA CCTAGCTTCT ATGATCTTGT CCTTCAGTAC ACTAGCACAA AATGATTTGA CGCTTTCCGA GATCTATATG
AGATGAGATT TATACTGAAG CTAAATTTTG TTGAACTATG TTGCAGAGTA TGCATACACG ATGAGGTTGA CGATGGCTGG
CAACGTTTAC AGCTTTGGAG TAATCTTACT GGAGCTTTTG ACTGGGAAAC CATCGGTCAG TGATGGCATC GAGTTAGCCA
AGTGGGCTCT GAGTCTTTCA GGCAGCCCTG ATCAGAGGGA GCAGATCCTT GACACCAGGG TCTCAAGAAC TTCAGCTGCT
GTTCACAGCC AGATGTTGTC GGTCCTGAAC ATCGCCCTCG CTTGTGTTGC GCTCTCTCCA GATGCTCGAC CAAAGATGCG
CACCGTCTTG AGGATGCTAT TCAACGCAAA GTGATCTGGC ATGATATGTT TTGGTAGCTT AGGTAGGTTC TGAATGGAGT
TTGATCATTT TGCTTAGTTT GTGGATGTCA GCAATCAGTA TACGGGGTCC TTGTATAGTA CCAGCACCAT AGTTCAAGGT
AGAGTAGTAG ATTATGATAT GGCTGATCAA TTTAGTATTC AGATATCTAT TTTGGAATGA ATGACCAATG GGTTTATCTA
TGCTGTATCA TCATATATTC ACACATGGTT ATTAGCATAC CTTGTACACG GCAATTCCAT ATAACAATAG TAGTGAAATA
GAGCCATAGT TAAGGTAGAA CAGTAGATAG ACTATGATAT ATATCCCTGA ACAATTTAGA AGCCAGATAT CTGTTTTGGA
ATGAATCAGG AATTGTGTTC TTCTATGCTA TATGATCATA TTTGTAAATG GTTGGTTGTG TACATCCATG TGGGATGTCG
AGGCCGGATT GGCATCCATT ATCTAACAAA CATATATATA AATTGTTATT ACTTATTAGC 

Locus: Os12g0182300

Loading...

Locus: Os12g0182300

Loading...