Os12t0183300-01

Locus

Os12g0183300

Description

Similar to 3'(2'),5'-bisphosphate nucleotidase.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

RHL

Oryzabase Gene Name Synonym(s)

Hal2-like protein, HAL2 Homolog

Transcript Evidence

AK058937 (DDBJ, Best hit)

Protein Evidence

P0C5A3 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: inositol or phosphatidylinositol phosphatase activity (GO:0004437)

Functional domain (InterPro)

Inositol monophosphatase (IPR000760)

Inositol monophosphatase, conserved site (IPR020550)

Full-length cDNA

001-009-F07 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0183300-01)

RiceXPro (AK058937)

Others

Oryzabase (13752)

KEGG (Os12t0183300-01 (EC:3.1.3.7))

Transcript

848 bp

>Os12t0183300-01 Similar to 3'(2'),5'-bisphosphate nucleotidase.
TGGCTCTGCTTGATGAGGGTAAAGTTGTTTTGGGTGTATTGGCTTGTCCCAACCTTTCTT
TGGGATCAATAGGCAACCTTAATGGTGGCTCCTCGGGAGATCAAGTTGGTGCTCTCTTTT
CTGCTACTATTGGTTGTGGAGCTGAAGTAGAGTCTTTACAGGGCTCTCCAGCACAAAAGA
TTAGTGTCTGTTCCATCGACAATCCAGTCGAAGCTTCATTCTTTGAGTCCTACGAAGGGG
CACACTCCTTGCGTGATTTAACAGGCTCCATTGCGGAGAAACTTGGTGTCCAAGCTCCTC
CAGTTAGAATTGATAGCCAAGCAAAATACGGTGCCCTAGCCCGAGGTGACGGTGCCATTT
ACTTGCGTTTTCCACACAAAGGTTACAGAGAGAAGATCTGGGATCATGCAGCTGGGTCAA
TCGTCGTGACAGAAGCTGGAGGTCTGGTGACAGATGCATCAGGAAACGATTTGGATTTCT
CCAAAGGGAGATTTCTTGATCTCGACACAGGGATCATCGCGACGAACAAGCAGCTGATGC
CTTCACTCCTGAAGGCTGTGCAAGATGCCATCAAGGAGCAAAACCAGGCTGCTTCCCCGT
TGTAGTAGCTGTCTCAATCCACAATCCACAAATATCATAATGTTTCCATATAATAATAAT
TGCAGTGCTGCTTCCCCATCAACATTACTTTAAATGTGTGTACAGCACCACTTTGTTGTT
GTTGCTGCTGCAAATTCAGTATCTTATTGTTGCACATTTCTGCATCTAATTGGTGGGTGA
GCTGGCACCACATGAATGTTCTTTCATCTGGATTCAGAAGAAATAATTAAATTGGCCTGA
TTCTCCCT

CDS

603 bp

>Os12t0183300-01 Similar to 3'(2'),5'-bisphosphate nucleotidase.
GCTCTGCTTGATGAGGGTAAAGTTGTTTTGGGTGTATTGGCTTGTCCCAACCTTTCTTTG
GGATCAATAGGCAACCTTAATGGTGGCTCCTCGGGAGATCAAGTTGGTGCTCTCTTTTCT
GCTACTATTGGTTGTGGAGCTGAAGTAGAGTCTTTACAGGGCTCTCCAGCACAAAAGATT
AGTGTCTGTTCCATCGACAATCCAGTCGAAGCTTCATTCTTTGAGTCCTACGAAGGGGCA
CACTCCTTGCGTGATTTAACAGGCTCCATTGCGGAGAAACTTGGTGTCCAAGCTCCTCCA
GTTAGAATTGATAGCCAAGCAAAATACGGTGCCCTAGCCCGAGGTGACGGTGCCATTTAC
TTGCGTTTTCCACACAAAGGTTACAGAGAGAAGATCTGGGATCATGCAGCTGGGTCAATC
GTCGTGACAGAAGCTGGAGGTCTGGTGACAGATGCATCAGGAAACGATTTGGATTTCTCC
AAAGGGAGATTTCTTGATCTCGACACAGGGATCATCGCGACGAACAAGCAGCTGATGCCT
TCACTCCTGAAGGCTGTGCAAGATGCCATCAAGGAGCAAAACCAGGCTGCTTCCCCGTTG
TAG

Protein

201 aa

>Os12t0183300-01 Similar to 3'(2'),5'-bisphosphate nucleotidase.
ALLDEGKVVLGVLACPNLSLGSIGNLNGGSSGDQVGALFSATIGCGAEVESLQGSPAQKI
SVCSIDNPVEASFFESYEGAHSLRDLTGSIAEKLGVQAPPVRIDSQAKYGALARGDGAIY
LRFPHKGYREKIWDHAAGSIVVTEAGGLVTDASGNDLDFSKGRFLDLDTGIIATNKQLMP
SLLKAVQDAIKEQNQAASPL*

5'UTR

chr12:4217769..4217770 (- strand) : 2 bp

CDS

chr12:4217592..4217768 (- strand) : 177 bp

chr12:4217392..4217490 (- strand) : 99 bp

chr12:4217161..4217314 (- strand) : 154 bp

chr12:4216826..4216998 (- strand) : 173 bp

3'UTR

chr12:4216583..4216825 (- strand) : 243 bp

FASTA

>Os12t0183300-01 class=Sequence position=chr12:4216583..4217770 (- strand)
TGGCTCTGCT TGATGAGGGT AAAGTTGTTT TGGGTGTATT GGCTTGTCCC AACCTTTCTT TGGGATCAAT AGGCAACCTT
AATGGTGGCT CCTCGGGAGA TCAAGTTGGT GCTCTCTTTT CTGCTACTAT TGGTTGTGGA GCTGAAGTAG AGTCTTTACA
GGGCTCTCCA GCACAAAAGG TTACATCTCC TTTTATTTCA TATTATAACT TTGACTTACT TTTACCTATT TGAGAATGGA
ACTAATTTTT TAATCTGCTT TTGGTTATTT TCACTTCCAG ATTAGTGTCT GTTCCATCGA CAATCCAGTC GAAGCTTCAT
TCTTTGAGTC CTACGAAGGG GCACACTCCT TGCGTGATTT AACAGGCTCC ATTGCGGAGG TTTGTCCTGA ATTATTCTTT
GCCTAGTACA GGTCCACGAG AGTTACTTGG GTAATCTGGT GTTTGAATGC TGGCAGAAAC TTGGTGTCCA AGCTCCTCCA
GTTAGAATTG ATAGCCAAGC AAAATACGGT GCCCTAGCCC GAGGTGACGG TGCCATTTAC TTGCGTTTTC CACACAAAGG
TTACAGAGAG AAGATCTGGG ATCATGCAGC TGGGTCAATC GTCGTGACAG GTATGAAGGT TCTCTTTTTG AACATTGAAA
ACATAGAACC CAACAACCTG AAAAAAAACA TAGAACCCAA CTGAAACATT TTAGATTGAT ATTCTGCTTG TGCTAAAACG
TAGAAACCAA CTGAAACATT TTAGATTGAT ATTCTGCTTG TGCTGTTTTC AGAAGCTGGA GGTCTGGTGA CAGATGCATC
AGGAAACGAT TTGGATTTCT CCAAAGGGAG ATTTCTTGAT CTCGACACAG GGATCATCGC GACGAACAAG CAGCTGATGC
CTTCACTCCT GAAGGCTGTG CAAGATGCCA TCAAGGAGCA AAACCAGGCT GCTTCCCCGT TGTAGTAGCT GTCTCAATCC
ACAATCCACA AATATCATAA TGTTTCCATA TAATAATAAT TGCAGTGCTG CTTCCCCATC AACATTACTT TAAATGTGTG
TACAGCACCA CTTTGTTGTT GTTGCTGCTG CAAATTCAGT ATCTTATTGT TGCACATTTC TGCATCTAAT TGGTGGGTGA
GCTGGCACCA CATGAATGTT CTTTCATCTG GATTCAGAAG AAATAATTAA ATTGGCCTGA TTCTCCCT