Os12t0210300-01

Locus

Os12g0210300

Description

Zeta class glutathione transferase, Cold tolerance

RAP-DB Gene Symbol Synonym(s)

OsGSTZ2

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

GSTZ2

CGSNL Gene Name

ZETA GLUTATHIONE S-TRANSFERASE 2

Oryzabase Gene Symbol Synonym(s)

OsGSTZ2, GSTZ-2

Oryzabase Gene Name Synonym(s)

glutathione S-transferase2, glutathione S-transferase 2, Glutathione S-transferase (GSTZ)-2, Glutathione S-transferase-2, glutathione transferase Z2

Transcript Evidence

AK065921

Protein Evidence

Q945X3

Literature

PMID: 21281270

Note

Manual Curation

September 24, 2020

Gene Ontology (GO)

Biological Process: aromatic amino acid family metabolic process (GO:0009072)

Molecular Function: catalytic activity (GO:0003824)

Molecular Function: protein binding (GO:0005515)

Cellular Component: cytoplasm (GO:0005737)

Functional domain (InterPro)

Thioredoxin-like superfamily (IPR036249)

Glutathione S-transferase, C-terminal domain superfamily (IPR036282)

Glutathione Transferase family (IPR040079)

Glutathione S-transferases, class Zeta (IPR005955)

Glutathione S-transferase, N-terminal (IPR004045)

Glutathione S-transferase, C-terminal-like (IPR010987)

Glutathione S-transferases, class Zeta , C-terminal (IPR034330)

Glutathione S-transferase, C-terminal (IPR004046)

Full-length cDNA

J013048G20 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0210300-01)

RiceXPro (AK065921)

Others

Oryzabase (2872)

KEGG (Os12t0210300-01 (EC:2.5.1.18, EC:5.2.1.2))

Transcript

1010 bp

>Os12t0210300-01 Zeta class glutathione transferase, Cold tolerance
AATTCATCTCCACATTCTTCATTCTCCATTAATTTCACGGTTTCATCTCGACATCTCATC
ATCTGTTTTAAGTTGCTAGCTGAGGAGGAGGAGCAGGTGCCAGCAATGGCGTCGTCAAAG
CCAATCCTGTACGGTGCCTGGATCAGCTCCTGCTCTCACCGAATCCGGATCGTTCTCAAT
CTCAAAGGTGTGGATTATGAGTACAAGTCAGTCAATCCTCGAACAGATCCAGACTATGAG
AAAATCAATCCAATTAAGTACATACCAGCATTAGTAGATGGAGACCTAGTTGTTTCTGAC
TCTCTCGCCATTGCATTGTATCTTGAAGATAAATACCCTCAACATGCTCTCCTACCTAAG
GATCTCAAAAAGAAAGCTCTTAATCTTCAGATTGCAAACATAGTTTGTTCAAGCATCCAA
CCTCTCCAAGGTTATGCTGTAATTGGTTTGCATGAGGGTAAGCTAAGCCCCGATGAGAGT
CTTCAGATAGTTCAGCATTATATTGATAAGGGCTTCAAAGCAATCGAAAAGCTTTTAGAA
GGATCCAACTTTAAATATGCTACTGGGGACGAAGTTCAATTGGGGGATGTGTTTCTAGCA
CCACAGATCCATGCTGGCATAAATCGCTTCCAAATTGATATCACAAAGTACCCAAATTTG
GCAAGACTCCATGACACATACATGGAAATTCCTGCATTTCAGGCAGCACTTCCAAAGAAT
CAGCCAGATGCACCTTCATGCTAAAATCAAGATTGCAAACAAGCTGCCATATCCAAAGGT
GCAAGACCTGCTTGCCCTTGTATAAGAGGGTCAGTGTTTGAGAATGTGGCTCTCCACCAA
CCATGTCATATTGTCATTTTGCATGAATGTCTAAGTTTGTTAGTTCTAAAAACAGCAGAA
ATGTGTTAACAGATGTTTTGAATGTATGTAACTGGGGTTCCACAAATCAAATATAAGCAG
CTCAACTCAAGTGCTCAGTCACACTTTGGTAATAAATACGGAATTTGTCA

CDS

639 bp

>Os12t0210300-01 Zeta class glutathione transferase, Cold tolerance
ATGGCGTCGTCAAAGCCAATCCTGTACGGTGCCTGGATCAGCTCCTGCTCTCACCGAATC
CGGATCGTTCTCAATCTCAAAGGTGTGGATTATGAGTACAAGTCAGTCAATCCTCGAACA
GATCCAGACTATGAGAAAATCAATCCAATTAAGTACATACCAGCATTAGTAGATGGAGAC
CTAGTTGTTTCTGACTCTCTCGCCATTGCATTGTATCTTGAAGATAAATACCCTCAACAT
GCTCTCCTACCTAAGGATCTCAAAAAGAAAGCTCTTAATCTTCAGATTGCAAACATAGTT
TGTTCAAGCATCCAACCTCTCCAAGGTTATGCTGTAATTGGTTTGCATGAGGGTAAGCTA
AGCCCCGATGAGAGTCTTCAGATAGTTCAGCATTATATTGATAAGGGCTTCAAAGCAATC
GAAAAGCTTTTAGAAGGATCCAACTTTAAATATGCTACTGGGGACGAAGTTCAATTGGGG
GATGTGTTTCTAGCACCACAGATCCATGCTGGCATAAATCGCTTCCAAATTGATATCACA
AAGTACCCAAATTTGGCAAGACTCCATGACACATACATGGAAATTCCTGCATTTCAGGCA
GCACTTCCAAAGAATCAGCCAGATGCACCTTCATGCTAA

Protein

212 aa

>Os12t0210300-01 Zeta class glutathione transferase, Cold tolerance
MASSKPILYGAWISSCSHRIRIVLNLKGVDYEYKSVNPRTDPDYEKINPIKYIPALVDGD
LVVSDSLAIALYLEDKYPQHALLPKDLKKKALNLQIANIVCSSIQPLQGYAVIGLHEGKL
SPDESLQIVQHYIDKGFKAIEKLLEGSNFKYATGDEVQLGDVFLAPQIHAGINRFQIDIT
KYPNLARLHDTYMEIPAFQAALPKNQPDAPSC*

5'UTR

chr12:5760537..5760641 (+ strand) : 105 bp

CDS

chr12:5760642..5760723 (+ strand) : 82 bp

chr12:5761248..5761292 (+ strand) : 45 bp

chr12:5761691..5761776 (+ strand) : 86 bp

chr12:5761889..5761960 (+ strand) : 72 bp

chr12:5762211..5762264 (+ strand) : 54 bp

chr12:5762386..5762461 (+ strand) : 76 bp

chr12:5762779..5762840 (+ strand) : 62 bp

chr12:5763175..5763234 (+ strand) : 60 bp

chr12:5763332..5763433 (+ strand) : 102 bp

3'UTR

chr12:5763434..5763699 (+ strand) : 266 bp

FASTA

>Os12t0210300-01 class=Sequence position=chr12:5760537..5763699 (+ strand)
AATTCATCTC CACATTCTTC ATTCTCCATT AATTTCACGG TTTCATCTCG ACATCTCATC ATCTGTTTTA AGTTGCTAGC
TGAGGAGGAG GAGCAGGTGC CAGCAATGGC GTCGTCAAAG CCAATCCTGT ACGGTGCCTG GATCAGCTCC TGCTCTCACC
GAATCCGGAT CGTTCTCAAT CTCAAAGGTA AGCAATTCTT GAGCAATTGG AGCGAGCTTG CTTGATTCTT TAGCCTCACT
GAGCTTCAAC AAATTAGTTG TGGTTTAGTC AACACTCTTA CTGATTTAGC TAAGAGGGTC AGGGAAGATG TGGCCTCTTC
ATGATGTAAA CACTCTTAAG TTTTGCAACA GTCAGGTCTA GAGTTATCTA TTTGCTGGGC CAATACTGAG AACTCCATCT
GTTAGAGGTG GCTCAGGAAC AGTTGTGTAA AAGTAACTCT AAAGAAGAAA GGAAAGATCA GATATGCACT TGATTAATTG
ATTTCCTTTA GTTTGATGCT CCTGACAGTC TGGCTCTGCA AAATTTTTGT CAATAGAACC TGATGATATG CTGATTTGTC
AATTGACAAC TAACAGATTC ACAGTTAAAA TTTGATTACA ATTGATGAGC CACAAACTTG GAGCATACTT TTCTATCAGA
TGATATGCAT TGTAAGTTCT TATAGTTGGA TAAGCTAAAA ATAAAATAAA TCATTTTTCT CTGTGCTGAA GGTGTGGATT
ATGAGTACAA GTCAGTCAAT CCTCGAACAG ATCCAGGTAA CCAAATAGTC ACACACATTT CATGTTTTAC ACTATGCACT
TCATTTCTGC TTTTGGAATT GATGATATAC AAGGAAGGGT GACCATGGTC TGAGTTAATC CAATGGATGA AAATATGATG
CCATTAGAAC TAGATGTGAT TGAGGATGAG GATGCTTATT ACCTCAGTAT TCAATAGGAT TCTCTTGTCA CTTAGAATTC
CTTGCTGACT GCATACAGAC AATTAATTTC CTTGACATTG GAATTGCAGT ATGCTTGATA AATTCAGTGT GTTCTCTTTG
ATAATGAACG ATAAAATGCT TTCTCCGTCA TTGCTTCATC ATAGTATCTT TAATGTTCAC AAGTTACTAT TGCATTATCT
AACAATTACA TATTATTGTG ATTTCCATTT GTAGACTATG AGAAAATCAA TCCAATTAAG TACATACCAG CATTAGTAGA
TGGAGACCTA GTTGTTTCTG ACTCTCTCGC CATTGCATTG GTGAGTATAG CTAGCACTTC AGTTTTTATT TTTCTCTCAT
GGATTTATTT CTCCAATATG CAAATGTATA TGTTAGTCAT TAACAAACTT TATTGTTTTT ATAAAAAAAC AGTATCTTGA
AGATAAATAC CCTCAACATG CTCTCCTACC TAAGGATCTC AAAAAGAAAG CTCTTAATCT TCAGGTATAT GTCATATGCC
AAAGTTTCTG TATCTTGTGC TACTACTGAA TTATTTGTCC ATATTTCTCC TGTCCTATGG CACAAAAACG GTTTGCTGAA
CTGAATAAAA AGGTCTTTGA ACTTTCAGTG TTTTGTTTGC ACATATACTG TCCATAAGTT GTATATTTTC ATGTGAATAT
GCAAAAAATA ATTGACATCG AGCACACTTT TATCTGCTCC CCATTTGAAT ATGTGTATTC CTTCCTTGTT ACAGATTGCA
AACATAGTTT GTTCAAGCAT CCAACCTCTC CAAGGTTATG CTGTAATTGT AAGTTTTTTG GCTTTTTGCC AACAGCTAGT
TACCACTGCG GAGTTTTTGT CGTTGCAACT AATTTCTGTA TTAGTGCAAT GGTGTTTGTG GAATATTAAT TTATGGGACC
AATTTACAGG GTTTGCATGA GGGTAAGCTA AGCCCCGATG AGAGTCTTCA GATAGTTCAG CATTATATTG ATAAGGGCTT
CAAAGGTTTG TATTTTCCAT CTGGTTTGGA AATATAATAT CTTCTTCTAC CTTCAGTGCT AAAATAAATA CGAGACATAT
TTCTTTGTTC TATATTGCAT TTACATTTCT GGATATCCTT GTCAAAAGTG TTGTGGAAGT GTGTGAATTT ATAAGACATG
CATGTTGTTG TTGTAGTATC TTCTGCATTG TTGGAAAATG AATGTAAATC AGTTGACAAC GTCCATTACT TTAAATTTAC
AAGAGATCAG TAACTATTTG AATTTGTCCT TTTTAGTGAT ACTTACAGTT CCATCTTGGC TTGCCCTTAT TCTTTGTTTC
AGCAATCGAA AAGCTTTTAG AAGGATCCAA CTTTAAATAT GCTACTGGGG ACGAAGTTCA ATTGGTTTGT ATTCCTAACC
AATGCTTCTT TATTGATACA TCTCTTCCCT TTATCGATCA CTCTGAAATG AGATTCAATC ATTTTAGGAA AAAAAAACTT
CAAAAGGTCA TGTTTTTGGA AAAAAAAAAG CTTGCAATCT GCATATCAGA AAACCATATA TACAGTTTTG TCCAACAAAA
TTTTATACTT CATTTGGCTT ACACCTTCCT TAATCAACCT AGTGAatatg acatctcatt aatatttatg cttattagta
tttgaagata gggttaatat tcatgtttct tctgcaatga atttttaatt aatatgatct tctatgtttt gcatacAGGG
GGATGTGTTT CTAGCACCAC AGATCCATGC TGGCATAAAT CGCTTCCAAA TTGATATCGT ACGCAACTTT CCTCTGCTAT
TGGCTCTACA TATAACGAGC GTTCCCATCC TAATTGATTC AGAAATATCA GCAATGAAAT TTTGTTTTCT TGCAGACAAA
GTACCCAAAT TTGGCAAGAC TCCATGACAC ATACATGGAA ATTCCTGCAT TTCAGGCAGC ACTTCCAAAG AATCAGCCAG
ATGCACCTTC ATGCTAAAAT CAAGATTGCA AACAAGCTGC CATATCCAAA GGTGCAAGAC CTGCTTGCCC TTGTATAAGA
GGGTCAGTGT TTGAGAATGT GGCTCTCCAC CAACCATGTC ATATTGTCAT TTTGCATGAA TGTCTAAGTT TGTTAGTTCT
AAAAACAGCA GAAATGTGTT AACAGATGTT TTGAATGTAT GTAACTGGGG TTCCACAAAT CAAATATAAG CAGCTCAACT
CAAGTGCTCA GTCACACTTT GGTAATAAAT ACGGAATTTG TCA

Locus: Os12g0210300

Loading...

Locus: Os12g0210300

Loading...