Os12t0239900-01

Locus

Os12g0239900

Description

Similar to PDR-like ABC transporter.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PDR22

CGSNL Gene Name

PLEIOTROPIC DRUG RESISTANCE 22

Oryzabase Gene Symbol Synonym(s)

OsABCG49, OsPDR22, OsABCG49_1, OsABCG49_2

Oryzabase Gene Name Synonym(s)

ABC transporter superfamily ABCG subgroup member 49, pleiotropic drug resistance 22

Transcript Evidence

AK107869 (DDBJ, Best hit)

Protein Evidence

Q8GU83 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

002-134-C05 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0239900-01)

RiceXPro (AK107869)

Others

Oryzabase (12022)

KEGG (Os12t0239900-01)

Transcript

553 bp

>Os12t0239900-01 Similar to PDR-like ABC transporter.
ACGCTGAATCTCCTCTTCACCACACAGTTCGGATTCGAGGACAACAGCAACATCCTTGTC
TTTGGAGAGACTAAACCGATCGCAGCCTTCGTAAGAGACTATTTTGGTTTCCACCGCGAG
CTGCTACCACTTTCTGCCATAATATTGGCAGCATACCCTGTCCTCTTCGCCATCCTGTAC
GGGTACAGCATCTCAAGGTTTAACTTCCAAAAGAGATAGACAGATCAGGGGTGTAAATAG
GAAAATTTGAACAGGATAATAACTGAACCACATGTCCATTACCATATAAGTTGAGCCGGA
TTCGAATACGAACCGGATATCTGTTGAATGTGGATATGGATACAGATTCAGATTAGATAT
TGGTCTGTTTCAATCAGATTCGGTTATCCACTAATTGCAATGATGACAAAAATTTAATAG
TCCAAGAGACTTATATACTATTGTATTAAATTTAAGTGAGAAGAAATGTAATGGCAGTCT
TGTTTGGTTACAGCAATATGAAGGCTGAACTTCCAAAAGTAAAAACATACTATCATGGCA
AAGTTTTATCTTC

CDS

219 bp

>Os12t0239900-01 Similar to PDR-like ABC transporter.
ACGCTGAATCTCCTCTTCACCACACAGTTCGGATTCGAGGACAACAGCAACATCCTTGTC
TTTGGAGAGACTAAACCGATCGCAGCCTTCGTAAGAGACTATTTTGGTTTCCACCGCGAG
CTGCTACCACTTTCTGCCATAATATTGGCAGCATACCCTGTCCTCTTCGCCATCCTGTAC
GGGTACAGCATCTCAAGGTTTAACTTCCAAAAGAGATAG

Protein

72 aa

>Os12t0239900-01 Similar to PDR-like ABC transporter.
TLNLLFTTQFGFEDNSNILVFGETKPIAAFVRDYFGFHRELLPLSAIILAAYPVLFAILY
GYSISRFNFQKR*

CDS

chr12:7731743..7731961 (- strand) : 219 bp

3'UTR

chr12:7731409..7731742 (- strand) : 334 bp

FASTA

>Os12t0239900-01 class=Sequence position=chr12:7731409..7731961 (- strand)
ACGCTGAATC TCCTCTTCAC CACACAGTTC GGATTCGAGG ACAACAGCAA CATCCTTGTC TTTGGAGAGA CTAAACCGAT
CGCAGCCTTC GTAAGAGACT ATTTTGGTTT CCACCGCGAG CTGCTACCAC TTTCTGCCAT AATATTGGCA GCATACCCTG
TCCTCTTCGC CATCCTGTAC GGGTACAGCA TCTCAAGGTT TAACTTCCAA AAGAGATAGA CAGATCAGGG GTGTAAATAG
GAAAATTTGA ACAGGATAAT AACTGAACCA CATGTCCATT ACCATATAAG TTGAGCCGGA TTCGAATACG AACCGGATAT
CTGTTGAATG TGGATATGGA TACAGATTCA GATTAGATAT TGGTCTGTTT CAATCAGATT CGGTTATCCA CTAATTGCAA
TGATGACAAA AATTTAATAG TCCAAGAGAC TTATATACTA TTGTATTAAA TTTAAGTGAG AAGAAATGTA ATGGCAGTCT
TGTTTGGTTA CAGCAATATG AAGGCTGAAC TTCCAAAAGT AAAAACATAC TATCATGGCA AAGTTTTATC TTC

Locus: Os12g0239900

Loading...

Locus: Os12g0239900

Loading...