Os12t0244100-01

Locus

Os12g0244100

Description

Plastid heat shock protein 70, Amyloplast development, Regulation of protein import into amyloplast

RAP-DB Gene Symbol Synonym(s)

FLO11, OsHsp70cp-2, OsHsp70CP2

RAP-DB Gene Name Synonym(s)

FLOURY ENDOSPERM11, heat shock protein 70 chloroplast protein 2

CGSNL Gene Symbol

HSP70CP2

CGSNL Gene Name

HEAT SHOCK PROTEIN 70KD CHLOROPLAST PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsHsp70CP2

Oryzabase Gene Name Synonym(s)

heat shock protein 70 chloroplast protein 2

Transcript Evidence

AK121949

Protein Evidence

Q2QV45

Literature

PMID: 30466604

PMID: 23394789

Note

Manual Curation

December 7, 2018

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein 70kD, peptide-binding domain superfamily (IPR029047)

Heat shock protein 70kD, C-terminal domain superfamily (IPR029048)

Heat shock protein 70 family (IPR013126)

Chaperone DnaK (IPR012725)

Heat shock protein 70, conserved site (IPR018181)

Experimentally confirmed subcellular location

plastid (GO:0009536)

Full-length cDNA

J033107J07 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0244100-01)

RiceXPro (AK121949)

Others

Oryzabase (13067)

KEGG (Os12t0244100-01)

Transcript

2459 bp

>Os12t0244100-01 Plastid heat shock protein 70, Amyloplast development, Regulation of protein import into amyloplast
CCGCCTGAATCCTTCTCCCTCGCCGGGTTAGGGTTTCCTCGCCTCGCCATGGCCTCCTTC
ACCTCCCAGCTCGGCGCCATGGCGTGCGGCGCCGCCCCCTCCACCTCGCCCCTCGCGGCC
CGGAGGAGCGGGCAGCTGTTCGTGGGGCGGAAGCCCGCGGCGGCGTCGGTGCAGATGCGG
GTGCCGCGGGCGGGGCGGGCGCGGGGGGTGGCGATGCGGGTGGCGTGCGAGAAGGTGGTG
GGGATCGACCTCGGGACGACCAACTCCGCGGTGGCGGCGATGGAGGGCGGGAAGCCGACG
GTCATCACCAACGCCGAGGGCCAGCGGACGACGCCCTCCGTGGTGGCGTACACCAAGGGC
GGGGAGCGGCTGGTCGGGCAGATCGCCAAGCGGCAGGCCGTCGTCAACCCGGAGAACACC
TTCTTCTCCGTCAAGCGCTTCATCGGCCGCAAGATGGCCGAGGTCGACGACGAGGCCAAG
CAGGTCTCCTACCACGTCGTCCGCGACGACAACGGCAACGTCAAGCTCGACTGCCCCGCC
ATCGGCAAGCAGTTCGCCGCCGAGGAGATTTCCGCGCAGGTCTTGAGGAAGTTGGTGGAC
GATGCATCTAAGTTTTTGAATGACAAAATTACCAAAGCAGTGGTTACTGTTCCTGCATAC
TTCAATGACTCACAGAGGACAGCAACAAAAGATGCTGGACGTATTGCAGGATtggaagtt
ctccgcattataaatgagccgactgctgcatcccttgcttatggttttgagaagaaaaac
aacgaaacgattcttgtgtttgacttgggaggcggtacctttgatgtctctgTATTGGAG
GTTGGAGATGGTGTGTTTGAGGTGCTTTCCACATCTGGTGACACACACCTTGGTGGCGAT
GACTTCGATAAGAAAGTTGTGGATTGGCTTGCTAGCAACTTTAAGAAAGATGAAGGCATT
GATCTTCTGAAAGACAAACAAGCCCTGCAGCGACTCACTGAGGCAGCAGAGAAAGCGAAG
ATGGAACTGTCTACGCTGTCTCAGACAAACATTAGCTTGCCTTTCATAACTGCTACTGCT
GATGGGCCTAAACACATCGAGACAACTCTCTCCAGAGCCAAATTTGAGGAGCTATGTTCG
GACCTCATTGATAGGCTTAAAACTCCTGTCACTAATGCCTTGAGAGATGCCAAACTGTCT
GTTGATAACCTGGACGAAGTGATTCTTGTTGGTGGATCCACTCGTATCCCTTCCGTGCAA
GAGCTTGTGAAGAAGATCACTGGCAAGGATCCCAATGTCACAGTCAACCCTGATGAGGTT
GTTTCTCTTGGGGCAGCTGTACAGGGTGGAGTTTTGGCCGGAGATGTGAAAGATGTCGTT
CTTCTTGATGTTACTCCATTGTCTCTTGGTCTGGAGACGTTGGGTGGAGTGATGACCAAG
ATTATTCCCAGAAACACAACACTGCCCACCTCAAAATCAGAGGTATTCTCCACAGCTGCA
GATGGACAGACAAGTGTTGAGATAAATGTTCTTCAGGGAGAGAGAGAGTTTGTCCGGGAC
AACAAGTCTCTTGGAAGCTTCCGCTTGGATGGAATCCCTCCTGCACCACGTGGTGTTCCA
CAAATTGAAGTCAAGTTTGATATTGATGCCAATGGTATTCTCTCTGTTGCTGCTATTGAT
AAGGGTACTGGGAAGAAACAGGATATCACCATCACCGGCGCTAGTACACTGCCAAAGGAT
GAGGTTGAGAGAATGGTGGAAGAGGCTGACAAGTTTGCTCAGGAGGACAAAGAGAAAAGA
GATGCCATTGATACCAAAAACCAGGCAGACTCTGTGGTCTACCAGACTGAGAAGCAACTG
AAGGAGCTAGGTGACAAGGTACCTGCACCTGTGAAAGAGAAGGTGGATGCAAAGCTCAAC
GAGCTCAAAGAGGCCATTGCGGGTGGATCAACACAGAGCATGAAGGATGCCATGGCTGCT
TTAAACGAGGAAGTTATGCAGATCGGCCAGGCCATGTACAACCAGCAGCCTAATGCTGGT
GCTGCTGGACCTACTCCTGGTGCCGATGCTGGACCGACAAGCTCAGGCGGTAAGGGACCG
AATGATGGAGATGTTATTGATGCGGATTTCACTGACAGCAATTGATAGTTCTAGCGATTG
AAGATTATTGATGGAAGGATGATCTGTGGTGGATGGCTGTGAGGGTCTGATGGGTGATGG
TATAGGAAGAAGGGAGTGAACAAATTGTTCTTTTTGTTTACTATGGATCCCATGTTCAAT
AGGCTCTTTAGTTTGCAATTTGATAGCGTAGGGTTTTGCCAACATTTTCCTGTGATGTTG
AATGAAGGATTATAAAAAGTAGCCTTCAAAAAAAGAGGAGGCAAAGGTTTTGATCGAAGA
AGTAGCTGATTGATATGACCTTGTTCCTTGAAAATAAAAATATCATTAGTTCCCTGTGC

CDS

2097 bp

>Os12t0244100-01 Plastid heat shock protein 70, Amyloplast development, Regulation of protein import into amyloplast
ATGGCCTCCTTCACCTCCCAGCTCGGCGCCATGGCGTGCGGCGCCGCCCCCTCCACCTCG
CCCCTCGCGGCCCGGAGGAGCGGGCAGCTGTTCGTGGGGCGGAAGCCCGCGGCGGCGTCG
GTGCAGATGCGGGTGCCGCGGGCGGGGCGGGCGCGGGGGGTGGCGATGCGGGTGGCGTGC
GAGAAGGTGGTGGGGATCGACCTCGGGACGACCAACTCCGCGGTGGCGGCGATGGAGGGC
GGGAAGCCGACGGTCATCACCAACGCCGAGGGCCAGCGGACGACGCCCTCCGTGGTGGCG
TACACCAAGGGCGGGGAGCGGCTGGTCGGGCAGATCGCCAAGCGGCAGGCCGTCGTCAAC
CCGGAGAACACCTTCTTCTCCGTCAAGCGCTTCATCGGCCGCAAGATGGCCGAGGTCGAC
GACGAGGCCAAGCAGGTCTCCTACCACGTCGTCCGCGACGACAACGGCAACGTCAAGCTC
GACTGCCCCGCCATCGGCAAGCAGTTCGCCGCCGAGGAGATTTCCGCGCAGGTCTTGAGG
AAGTTGGTGGACGATGCATCTAAGTTTTTGAATGACAAAATTACCAAAGCAGTGGTTACT
GTTCCTGCATACTTCAATGACTCACAGAGGACAGCAACAAAAGATGCTGGACGTATTGCA
GGATtggaagttctccgcattataaatgagccgactgctgcatcccttgcttatggtttt
gagaagaaaaacaacgaaacgattcttgtgtttgacttgggaggcggtacctttgatgtc
tctgTATTGGAGGTTGGAGATGGTGTGTTTGAGGTGCTTTCCACATCTGGTGACACACAC
CTTGGTGGCGATGACTTCGATAAGAAAGTTGTGGATTGGCTTGCTAGCAACTTTAAGAAA
GATGAAGGCATTGATCTTCTGAAAGACAAACAAGCCCTGCAGCGACTCACTGAGGCAGCA
GAGAAAGCGAAGATGGAACTGTCTACGCTGTCTCAGACAAACATTAGCTTGCCTTTCATA
ACTGCTACTGCTGATGGGCCTAAACACATCGAGACAACTCTCTCCAGAGCCAAATTTGAG
GAGCTATGTTCGGACCTCATTGATAGGCTTAAAACTCCTGTCACTAATGCCTTGAGAGAT
GCCAAACTGTCTGTTGATAACCTGGACGAAGTGATTCTTGTTGGTGGATCCACTCGTATC
CCTTCCGTGCAAGAGCTTGTGAAGAAGATCACTGGCAAGGATCCCAATGTCACAGTCAAC
CCTGATGAGGTTGTTTCTCTTGGGGCAGCTGTACAGGGTGGAGTTTTGGCCGGAGATGTG
AAAGATGTCGTTCTTCTTGATGTTACTCCATTGTCTCTTGGTCTGGAGACGTTGGGTGGA
GTGATGACCAAGATTATTCCCAGAAACACAACACTGCCCACCTCAAAATCAGAGGTATTC
TCCACAGCTGCAGATGGACAGACAAGTGTTGAGATAAATGTTCTTCAGGGAGAGAGAGAG
TTTGTCCGGGACAACAAGTCTCTTGGAAGCTTCCGCTTGGATGGAATCCCTCCTGCACCA
CGTGGTGTTCCACAAATTGAAGTCAAGTTTGATATTGATGCCAATGGTATTCTCTCTGTT
GCTGCTATTGATAAGGGTACTGGGAAGAAACAGGATATCACCATCACCGGCGCTAGTACA
CTGCCAAAGGATGAGGTTGAGAGAATGGTGGAAGAGGCTGACAAGTTTGCTCAGGAGGAC
AAAGAGAAAAGAGATGCCATTGATACCAAAAACCAGGCAGACTCTGTGGTCTACCAGACT
GAGAAGCAACTGAAGGAGCTAGGTGACAAGGTACCTGCACCTGTGAAAGAGAAGGTGGAT
GCAAAGCTCAACGAGCTCAAAGAGGCCATTGCGGGTGGATCAACACAGAGCATGAAGGAT
GCCATGGCTGCTTTAAACGAGGAAGTTATGCAGATCGGCCAGGCCATGTACAACCAGCAG
CCTAATGCTGGTGCTGCTGGACCTACTCCTGGTGCCGATGCTGGACCGACAAGCTCAGGC
GGTAAGGGACCGAATGATGGAGATGTTATTGATGCGGATTTCACTGACAGCAATTGA

Protein

699 aa

>Os12t0244100-01 Plastid heat shock protein 70, Amyloplast development, Regulation of protein import into amyloplast
MASFTSQLGAMACGAAPSTSPLAARRSGQLFVGRKPAAASVQMRVPRAGRARGVAMRVAC
EKVVGIDLGTTNSAVAAMEGGKPTVITNAEGQRTTPSVVAYTKGGERLVGQIAKRQAVVN
PENTFFSVKRFIGRKMAEVDDEAKQVSYHVVRDDNGNVKLDCPAIGKQFAAEEISAQVLR
KLVDDASKFLNDKITKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGF
EKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKKVVDWLASNFKK
DEGIDLLKDKQALQRLTEAAEKAKMELSTLSQTNISLPFITATADGPKHIETTLSRAKFE
ELCSDLIDRLKTPVTNALRDAKLSVDNLDEVILVGGSTRIPSVQELVKKITGKDPNVTVN
PDEVVSLGAAVQGGVLAGDVKDVVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVF
STAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSV
AAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDKEKRDAIDTKNQADSVVYQT
EKQLKELGDKVPAPVKEKVDAKLNELKEAIAGGSTQSMKDAMAALNEEVMQIGQAMYNQQ
PNAGAAGPTPGADAGPTSSGGKGPNDGDVIDADFTDSN*

5'UTR

chr12:7986193..7986240 (+ strand) : 48 bp

CDS

chr12:7986241..7986771 (+ strand) : 531 bp

chr12:7987618..7987870 (+ strand) : 253 bp

chr12:7988509..7988588 (+ strand) : 80 bp

chr12:7989407..7989549 (+ strand) : 143 bp

chr12:7989639..7989737 (+ strand) : 99 bp

chr12:7989843..7990032 (+ strand) : 190 bp

chr12:7990278..7990676 (+ strand) : 399 bp

chr12:7991133..7991534 (+ strand) : 402 bp

3'UTR

chr12:7991535..7991848 (+ strand) : 314 bp

FASTA

>Os12t0244100-01 class=Sequence position=chr12:7986193..7991848 (+ strand)
CCGCCTGAAT CCTTCTCCCT CGCCGGGTTA GGGTTTCCTC GCCTCGCCAT GGCCTCCTTC ACCTCCCAGC TCGGCGCCAT
GGCGTGCGGC GCCGCCCCCT CCACCTCGCC CCTCGCGGCC CGGAGGAGCG GGCAGCTGTT CGTGGGGCGG AAGCCCGCGG
CGGCGTCGGT GCAGATGCGG GTGCCGCGGG CGGGGCGGGC GCGGGGGGTG GCGATGCGGG TGGCGTGCGA GAAGGTGGTG
GGGATCGACC TCGGGACGAC CAACTCCGCG GTGGCGGCGA TGGAGGGCGG GAAGCCGACG GTCATCACCA ACGCCGAGGG
CCAGCGGACG ACGCCCTCCG TGGTGGCGTA CACCAAGGGC GGGGAGCGGC TGGTCGGGCA GATCGCCAAG CGGCAGGCCG
TCGTCAACCC GGAGAACACC TTCTTCTCCG TCAAGCGCTT CATCGGCCGC AAGATGGCCG AGGTCGACGA CGAGGCCAAG
CAGGTCTCCT ACCACGTCGT CCGCGACGAC AACGGCAACG TCAAGCTCGA CTGCCCCGCC ATCGGCAAGC AGTTCGCCGC
CGAGGAGATT TCCGCGCAGG TGATTTCTTC TGCTTCTTTA TTTTTTTTAG CTCTCAACTT CGATTTCTAT GTCAGTGAGA
CTTTTTGTTT GTTGGCCATA CATTCAATCT GTCACTCATT TTGTACCCAA AGGTGTGTTT CAGTTTCACT CAATTGGGGG
CACTTGGAAT GATTAAACAA TGAATTTGAA TATAATGATT AATCATATAA ATGTGATTGT TTAGGCGAAT TCAAAATACG
AAATTGGACT TGGAGGTATC GCCTCGGAAT AGATGTTGCT ATTTTTAGTT ATATGGGCGA GCTCAAGTTA TAATGGTTTA
TATGTTTTCC TGTATTTTTT GTTAGTTTTG TACAAAAACC AATCCTACCT GGATTTTTTT TTTTTGGGAT GGAGGGAGTA
TTGATTTACC TGTTAGTATG TTGGTAGCTT GGAAACCTAA GTTCTATAAT TATGCTCAAA TGTGTGTAAT GCCTAATCAG
CTTAAGATGG TCATGTATTC ATCTTGAACT TCTATCGGCA GTGAGGCAGT CTGAGTGATG GGAAGGAATC AACTAGTAAA
TCTTTTTCTT ATAGTGCACC ATTCTAAACT TGAAATGGTT TTGTGTTACC ATACTTAGCA CTTATCCACT GTTGATTAAG
ATAAAGTTTT CTGGCATCAC CAATTGCTAA TTTGAGTCAG GTTTAACATA TCCTCACTCA CCTATGCATG TGTAGGGACA
TAATAAATAC ATGGTTTGTC ACAGAGACAG GACCTAAGTT AAACAACACC TGAATGCTCA GGGTCCATAA TGGCATAATG
TAGCTTACAT TTTATTTACA TAGTAAATGG ATTACTAAAT TTCACTTTTC GGGTCAATGC AACAGGTCTT GAGGAAGTTG
GTGGACGATG CATCTAAGTT TTTGAATGAC AAAATTACCA AAGCAGTGGT TACTGTTCCT GCATACTTCA ATGACTCACA
GAGGACAGCA ACAAAAGATG CTGGACGTAT TGCAGGATtg gaagttctcc gcattataaa tgagccgact gctgcatccc
ttgcttatgg ttttgagaag aaaaacaacg aaacgattct tgtgtttgac ttgggaggcg gtacctttga tgtctctggt
atGTTATGTG CTAGAACACC AAACTGTTTA CTTTTCTTGC ACTATTACTG TAGCATAGGG ATCTCGTGGA CCTGAATCTT
ATCATACTTC TATGACAGAC CTTTTTTCCT AGATGGATCG TACTGGAAAA TAGATGATGA ATTGATTTGA TCAAATGGAA
TGTGAAATGC TGTTGCTGTT TCATATCTGT GAAATCTTTT ACCAAGGTTC ACAACTGTTT AGCCAGAAAC ATGAGTTCTT
TATATGGTTC CTCCAGAACT TAATATATTG TCTTTTATGA AGGTTCAGAA CTATTTAGCC ACAAGCATGA GTTCTACTTT
ATATGGTCCC TCCTGAATTA AACATATCGT TACTAAATAT TTGAGTTGAG TAGCTCCTTG TTCTATCATC ATACATATAG
AGGCTGCCTC GAGTTTTTTT AAATAGATCA ATATTTAGTT AAAAGGGACT TTGGAAGAGA GATACTCAAA GCAGATTTTT
CTGCGAAAAT GACTTTGGAA GAATGAAACT TACTTCAGGA GTCCCTCAAT TGTGAAGTAT ATGGTTCATG TTGTGATGAA
AAAAATAGGA TGAGTCCTCA AACATGCCAT GATGTAATTG AATTGTGATC TCTACTAAAG AAACATTATC CTGCAGTATT
GGAGGTTGGA GATGGTGTGT TTGAGGTGCT TTCCACATCT GGTGACACAC ACCTTGGTGG CGATGACTTC GATAAGGTAT
GTAATTCCAT TTTTATTTTT AAGAGATTAA CTACTGCCGA ATCTCCATTT TGGAATTTCG TGAAAATACA TCGCAACTGT
TCGAACTGTT TTCTATGGAA TGTTGCACTA TGCATTTTTG ACAAATATTA TATGATGTGG TGCCTCTTAT GTGTATTACA
TTATTCTTTC TTTGGTAAAC TCACAATATC AGTCAACCAA AATTTCTCAA TAGGTTGCTC GTTCTATATA ATTATGTTAT
TGCAGTTTTA TTTCTGTTGG GTATTTTACT TTGGAGCCAT GACTCATGAA ACTCCTGTAA GTATGAGCTC TGTGTGTTTT
GTGCTGGAAT CTGACCTCTT CAAGCCTTCC ATATATTCTT TATGTAATGC CCATGACCTA AAAATATGTA ATTTGAACTT
TTGAAAGTCA ACTTAGGCTT Cgttcgttcc cgggtgatct gggagattga gagagaaaac atctcgtttt ccgcgcgcac
gcttcccaaa ctattaaatg gtgcgttttt tgcaaaaaaa attccataag aaagttgctt taaaaaatca tattaatcca
tttttaaaat ttaaaatagt taatactcaa ctaatcatac gctaatggct cacctcgttt tgtgtatctt tccaatcttc
ccaatctcct caatcccctt ctcctcaaac acacccTTAG CATATCAAAG GTCTATTGGC ATTGTAGTGT AGCTCCATGG
ACAACATACC TATCAGTTGA ACTGATTCTT TTACTGACAG TATGCTATAT TTATTGTTTT TTTTTAATTT GAATGTTATC
CTTGAATTAT GTAGAAAGTT GTGGATTGGC TTGCTAGCAA CTTTAAGAAA GATGAAGGCA TTGATCTTCT GAAAGACAAA
CAAGCCCTGC AGCGACTCAC TGAGGCAGCA GAGAAAGCGA AGATGGAACT GTCTACGCTG TCTCAGACAA ACATTAGGTG
AGCTTCTTTC CAATTGTTCT CACAGAGTAT TCTATTGCTC ATTTGGTGAT TTTTCTTCTT AAATAATTGA ATGTCTTGAA
TTGCAGCTTG CCTTTCATAA CTGCTACTGC TGATGGGCCT AAACACATCG AGACAACTCT CTCCAGAGCC AAATTTGAGG
AGCTATGTTC GGACCTCATT GATAGGTAAA ATATGGACAT TCTGCTGATA TATAAGCCTA TTGCTTAGGA AAATGATTTG
CATTTTCTCA AATTTTTTTA AGGCTTGACT AATATGTTTC TTATTGATAG GCTTAAAACT CCTGTCACTA ATGCCTTGAG
AGATGCCAAA CTGTCTGTTG ATAACCTGGA CGAAGTGATT CTTGTTGGTG GATCCACTCG TATCCCTTCC GTGCAAGAGC
TTGTGAAGAA GATCACTGGC AAGGATCCCA ATGTCACAGT CAACCCTGAT GAGGTTGTTT CTCTTGGGGC AGCTGTACAG
GTCACTTTCT TGTCCTCACA AGTGCTTTAA TTTGTTGTTC TTTGCAGAAA ATCATCCATA AACCTTCTAA TTACTTCACT
GATCTTAAGT GCATGTTTCC TGCATTATAG TGGATCACAA ATCAATTTAT ATGTATTTAA AACTAACTGC CCAAAGCGTG
TTTTAACACT GCCAAGACTG CATTTATCTT GTTCCGAATC TGAAATCTCA AATCAATATA TTTTGTGTTT CCCTTGTAAC
ACCAGGGTGG AGTTTTGGCC GGAGATGTGA AAGATGTCGT TCTTCTTGAT GTTACTCCAT TGTCTCTTGG TCTGGAGACG
TTGGGTGGAG TGATGACCAA GATTATTCCC AGAAACACAA CACTGCCCAC CTCAAAATCA GAGGTATTCT CCACAGCTGC
AGATGGACAG ACAAGTGTTG AGATAAATGT TCTTCAGGGA GAGAGAGAGT TTGTCCGGGA CAACAAGTCT CTTGGAAGCT
TCCGCTTGGA TGGAATCCCT CCTGCACCAC GTGGTGTTCC ACAAATTGAA GTCAAGTTTG ATATTGATGC CAATGGTATT
CTCTCTGTTG CTGCTATTGA TAAGGGTACT GGGAAGAAAC AGGATATCAC CATCACCGGC GCTAGTACAC TGCCAAAGGA
TGAGGTATGT TCCCACCTTA TTTGCTTAAG CATTGTGTGA TTACATTCAT CAAAAGTTGG TTGCCAGCTT GCTATATTGC
AACTAGGTAC AAAGTTGGCA AGTTTCTTCT TAACGTATGA TAGTTTTCTG CATGGTTATC TAGTTGTAGA TTTTCTTTTC
CACCATATGT TGTGCAGCTT CTTTCTTTGA TTCCCAATCC CGTTATTTGC TACTGGTGTG AAATTTATTT ACCAAATTTC
TTCTATTATG GTAGAGTTTT TCATATCTTT ACCAGATCGC ATGTATTGAC TATTTGTTTG CATATAATCT ATGTTGATGG
AAGAGTAATT GAATTTTTTG TGGTATAGAG TTTAGGTATC AGTTCCTCTA GGGAAACAAC ACTATGCTCC TGTAAGCGAA
GATACAAATG CCTACATTGA AGCATAACAT TCAATCTGAA ACAACATTTT GTGTTTGTAG GTTGAGAGAA TGGTGGAAGA
GGCTGACAAG TTTGCTCAGG AGGACAAAGA GAAAAGAGAT GCCATTGATA CCAAAAACCA GGCAGACTCT GTGGTCTACC
AGACTGAGAA GCAACTGAAG GAGCTAGGTG ACAAGGTACC TGCACCTGTG AAAGAGAAGG TGGATGCAAA GCTCAACGAG
CTCAAAGAGG CCATTGCGGG TGGATCAACA CAGAGCATGA AGGATGCCAT GGCTGCTTTA AACGAGGAAG TTATGCAGAT
CGGCCAGGCC ATGTACAACC AGCAGCCTAA TGCTGGTGCT GCTGGACCTA CTCCTGGTGC CGATGCTGGA CCGACAAGCT
CAGGCGGTAA GGGACCGAAT GATGGAGATG TTATTGATGC GGATTTCACT GACAGCAATT GATAGTTCTA GCGATTGAAG
ATTATTGATG GAAGGATGAT CTGTGGTGGA TGGCTGTGAG GGTCTGATGG GTGATGGTAT AGGAAGAAGG GAGTGAACAA
ATTGTTCTTT TTGTTTACTA TGGATCCCAT GTTCAATAGG CTCTTTAGTT TGCAATTTGA TAGCGTAGGG TTTTGCCAAC
ATTTTCCTGT GATGTTGAAT GAAGGATTAT AAAAAGTAGC CTTCAAAAAA AGAGGAGGCA AAGGTTTTGA TCGAAGAAGT
AGCTGATTGA TATGACCTTG TTCCTTGAAA ATAAAAATAT CATTAGTTCC CTGTGC

Locus: Os12g0244100

Loading...

Locus: Os12g0244100

Loading...