Os12t0244100-02

Locus

Os12g0244100

Description

Similar to stromal 70 kDa heat shock-related protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSP70CP2

CGSNL Gene Name

HEAT SHOCK PROTEIN 70KD CHLOROPLAST PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsHsp70CP2

Oryzabase Gene Name Synonym(s)

heat shock protein 70 chloroplast protein 2

Transcript Evidence

AK072071 (DDBJ, Best hit)

Protein Evidence

C7ENF7 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: protein folding (GO:0006457)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: unfolded protein binding (GO:0051082)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Chaperone DnaK (IPR012725)

Heat shock protein 70 (IPR013126)

Heat shock protein 70, conserved site (IPR018181)

Full-length cDNA

J013111L16 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0244100-02)

RiceXPro (AK072071)

Others

Oryzabase (13067)

KEGG (Os12t0244100-02)

Transcript

2201 bp

>Os12t0244100-02 Similar to stromal 70 kDa heat shock-related protein.
GGGACGACCAACTCCGCGGTGGCGGCGATGGAGGGCGGGAAGCCGACGGTCATCACCAAC
GCCGAGGGCCAGCGGACGACGCCCTCCGTGGTGGCGTACACCAAGGGCGGGGAGCGGCTG
GTCGGGCAGATCGCCAAGCGGCAGGCCGTCGTCAACCCGGAGAACACCTTCTTCTCCGTC
AAGCGCTTCATCGGCCGCAAGATGGCCGAGGTCGACGACGAGGCCAAGCAGGTCTCCTAC
CACGTCGTCCGCGACGACAACGGCAACGTCAAGCTCGACTGCCCCGCCATCGGCAAGCAG
TTCGCCGCCGAGGAGATTTCCGCGCAGGTCTTGAGGAAGTTGGTGGACGATGCATCTAAG
TTTTTGAATGACAAAATTACCAAAGCAGTGGTTACTGTTCCTGCATACTTCAATGACTCA
CAGAGGACAGCAACAAAAGATGCTGGACGTATTGCAGGATtggaagttctccgcattata
aatgagccgactgctgcatcccttgcttatggttttgagaagaaaaacaacgaaacgatt
cttgtgtttgacttgggaggcggtacctttgatgtctctgTATTGGAGGTTGGAGATGGT
GTGTTTGAGGTGCTTTCCACATCTGGTGACACACACCTTGGTGGCGATGACTTCGATAAG
AAAGTTGTGGATTGGCTTGCTAGCAACTTTAAGAAAGATGAAGGCATTGATCTTCTGAAA
GACAAACAAGCCCTGCAGCGACTCACTGAGGCAGCAGAGAAAGCGAAGATGGAACTGTCT
ACGCTGTCTCAGACAAACATTAGCTTGCCTTTCATAACTGCTACTGCTGATGGGCCTAAA
CACATCGAGACAACTCTCTCCAGAGCCAAATTTGAGGAGCTATGTTCGGACCTCATTGAT
AGGCTTAAAACTCCTGTCACTAATGCCTTGAGAGATGCCAAACTGTCTGTTGATAACCTG
GACGAAGTGATTCTTGTTGGTGGATCCACTCGTATCCCTTCCGTGCAAGAGCTTGTGAAG
AAGATCACTGGCAAGGATCCCAATGTCACAGTCAACCCTGATGAGGTTGTTTCTCTTGGG
GCAGCTGTACAGGGTGGAGTTTTGGCCGGAGATGTGAAAGATGTCGTTCTTCTTGATGTT
ACTCCATTGTCTCTTGGTCTGGAGACGTTGGGTGGAGTGATGACCAAGATTATTCCCAGA
AACACAACACTGCCCACCTCAAAATCAGAGGTATTCTCCACAGCTGCAGATGGACAGACA
AGTGTTGAGATAAATGTTCTTCAGGGAGAGAGAGAGTTTGTCCGGGACAACAAGTCTCTT
GGAAGCTTCCGCTTGGATGGAATCCCTCCTGCACCACGTGGTGTTCCACAAATTGAAGTC
AAGTTTGATATTGATGCCAATGGTATTCTCTCTGTTGCTGCTATTGATAAGGGTACTGGG
AAGAAACAGGATATCACCATCACCGGCGCTAGTACACTGCCAAAGGATGAGGTTGAGAGA
ATGGTGGAAGAGGCTGACAAGTTTGCTCAGGAGGACAAAGAGAAAAGAGATGCCATTGAT
ACCAAAAACCAGGCAGACTCTGTGGTCTACCAGACTGAGAAGCAACTGAAGGAGCTAGGT
GACAAGGTACCTGCACCTGTGAAAGAGAAGGTGGATGCAAAGCTCAACGAGCTCAAAGAG
GCCATTGCGGGTGGATCAACACAGAGCATGAAGGATGCCATGGCTGCTTTAAACGAGGAA
GTTATGCAGATCGGCCAGGCCATGTACAACCAGCAGCCTAATGCTGGTGCTGCTGGACCT
ACTCCTGGTGCCGATGCTGGACCGACAAGCTCAGGCGGTAAGGGACCGAATGATGGAGAT
GTTATTGATGCGGATTTCACTGACAGCAATTGATAGTTCTAGCGATTGAAGATTATTGAT
GGAAGGATGATCTGTGGTGGATGGCTGTGAGGGTCTGATGGGTGATGGTATAGGAAGAAG
GGAGTGAACAAATTGTTCTTTTTGTTTACTATGGATCCCATGTTCAATAGGCTCTTTAGT
TTGCAATTTGATAGCGTAGGGTTTTGCCAACATTTTCCTGTGATGTTGAATGAAGGATTA
TAAAAAGTAGCCTTCAAAAAAAGAGGAGGCAAAGGTTTTGATCGAAGAAGTAGCTGATTG
ATATGACCTTGTTCCTTGAAAATAAAAATATCATTAGTTCC

CDS

1893 bp

>Os12t0244100-02 Similar to stromal 70 kDa heat shock-related protein.
GGGACGACCAACTCCGCGGTGGCGGCGATGGAGGGCGGGAAGCCGACGGTCATCACCAAC
GCCGAGGGCCAGCGGACGACGCCCTCCGTGGTGGCGTACACCAAGGGCGGGGAGCGGCTG
GTCGGGCAGATCGCCAAGCGGCAGGCCGTCGTCAACCCGGAGAACACCTTCTTCTCCGTC
AAGCGCTTCATCGGCCGCAAGATGGCCGAGGTCGACGACGAGGCCAAGCAGGTCTCCTAC
CACGTCGTCCGCGACGACAACGGCAACGTCAAGCTCGACTGCCCCGCCATCGGCAAGCAG
TTCGCCGCCGAGGAGATTTCCGCGCAGGTCTTGAGGAAGTTGGTGGACGATGCATCTAAG
TTTTTGAATGACAAAATTACCAAAGCAGTGGTTACTGTTCCTGCATACTTCAATGACTCA
CAGAGGACAGCAACAAAAGATGCTGGACGTATTGCAGGATtggaagttctccgcattata
aatgagccgactgctgcatcccttgcttatggttttgagaagaaaaacaacgaaacgatt
cttgtgtttgacttgggaggcggtacctttgatgtctctgTATTGGAGGTTGGAGATGGT
GTGTTTGAGGTGCTTTCCACATCTGGTGACACACACCTTGGTGGCGATGACTTCGATAAG
AAAGTTGTGGATTGGCTTGCTAGCAACTTTAAGAAAGATGAAGGCATTGATCTTCTGAAA
GACAAACAAGCCCTGCAGCGACTCACTGAGGCAGCAGAGAAAGCGAAGATGGAACTGTCT
ACGCTGTCTCAGACAAACATTAGCTTGCCTTTCATAACTGCTACTGCTGATGGGCCTAAA
CACATCGAGACAACTCTCTCCAGAGCCAAATTTGAGGAGCTATGTTCGGACCTCATTGAT
AGGCTTAAAACTCCTGTCACTAATGCCTTGAGAGATGCCAAACTGTCTGTTGATAACCTG
GACGAAGTGATTCTTGTTGGTGGATCCACTCGTATCCCTTCCGTGCAAGAGCTTGTGAAG
AAGATCACTGGCAAGGATCCCAATGTCACAGTCAACCCTGATGAGGTTGTTTCTCTTGGG
GCAGCTGTACAGGGTGGAGTTTTGGCCGGAGATGTGAAAGATGTCGTTCTTCTTGATGTT
ACTCCATTGTCTCTTGGTCTGGAGACGTTGGGTGGAGTGATGACCAAGATTATTCCCAGA
AACACAACACTGCCCACCTCAAAATCAGAGGTATTCTCCACAGCTGCAGATGGACAGACA
AGTGTTGAGATAAATGTTCTTCAGGGAGAGAGAGAGTTTGTCCGGGACAACAAGTCTCTT
GGAAGCTTCCGCTTGGATGGAATCCCTCCTGCACCACGTGGTGTTCCACAAATTGAAGTC
AAGTTTGATATTGATGCCAATGGTATTCTCTCTGTTGCTGCTATTGATAAGGGTACTGGG
AAGAAACAGGATATCACCATCACCGGCGCTAGTACACTGCCAAAGGATGAGGTTGAGAGA
ATGGTGGAAGAGGCTGACAAGTTTGCTCAGGAGGACAAAGAGAAAAGAGATGCCATTGAT
ACCAAAAACCAGGCAGACTCTGTGGTCTACCAGACTGAGAAGCAACTGAAGGAGCTAGGT
GACAAGGTACCTGCACCTGTGAAAGAGAAGGTGGATGCAAAGCTCAACGAGCTCAAAGAG
GCCATTGCGGGTGGATCAACACAGAGCATGAAGGATGCCATGGCTGCTTTAAACGAGGAA
GTTATGCAGATCGGCCAGGCCATGTACAACCAGCAGCCTAATGCTGGTGCTGCTGGACCT
ACTCCTGGTGCCGATGCTGGACCGACAAGCTCAGGCGGTAAGGGACCGAATGATGGAGAT
GTTATTGATGCGGATTTCACTGACAGCAATTGA

Protein

631 aa

>Os12t0244100-02 Similar to stromal 70 kDa heat shock-related protein.
GTTNSAVAAMEGGKPTVITNAEGQRTTPSVVAYTKGGERLVGQIAKRQAVVNPENTFFSV
KRFIGRKMAEVDDEAKQVSYHVVRDDNGNVKLDCPAIGKQFAAEEISAQVLRKLVDDASK
FLNDKITKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIINEPTAASLAYGFEKKNNETI
LVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKKVVDWLASNFKKDEGIDLLK
DKQALQRLTEAAEKAKMELSTLSQTNISLPFITATADGPKHIETTLSRAKFEELCSDLID
RLKTPVTNALRDAKLSVDNLDEVILVGGSTRIPSVQELVKKITGKDPNVTVNPDEVVSLG
AAVQGGVLAGDVKDVVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQT
SVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVAAIDKGTG
KKQDITITGASTLPKDEVERMVEEADKFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELG
DKVPAPVKEKVDAKLNELKEAIAGGSTQSMKDAMAALNEEVMQIGQAMYNQQPNAGAAGP
TPGADAGPTSSGGKGPNDGDVIDADFTDSN*

CDS

chr12:7986445..7986771 (+ strand) : 327 bp

chr12:7987618..7987870 (+ strand) : 253 bp

chr12:7988509..7988588 (+ strand) : 80 bp

chr12:7989407..7989549 (+ strand) : 143 bp

chr12:7989639..7989737 (+ strand) : 99 bp

chr12:7989843..7990032 (+ strand) : 190 bp

chr12:7990278..7990676 (+ strand) : 399 bp

chr12:7991133..7991534 (+ strand) : 402 bp

3'UTR

chr12:7991535..7991842 (+ strand) : 308 bp

FASTA

>Os12t0244100-02 class=Sequence position=chr12:7986445..7991842 (+ strand)
GGGACGACCA ACTCCGCGGT GGCGGCGATG GAGGGCGGGA AGCCGACGGT CATCACCAAC GCCGAGGGCC AGCGGACGAC
GCCCTCCGTG GTGGCGTACA CCAAGGGCGG GGAGCGGCTG GTCGGGCAGA TCGCCAAGCG GCAGGCCGTC GTCAACCCGG
AGAACACCTT CTTCTCCGTC AAGCGCTTCA TCGGCCGCAA GATGGCCGAG GTCGACGACG AGGCCAAGCA GGTCTCCTAC
CACGTCGTCC GCGACGACAA CGGCAACGTC AAGCTCGACT GCCCCGCCAT CGGCAAGCAG TTCGCCGCCG AGGAGATTTC
CGCGCAGGTG ATTTCTTCTG CTTCTTTATT TTTTTTAGCT CTCAACTTCG ATTTCTATGT CAGTGAGACT TTTTGTTTGT
TGGCCATACA TTCAATCTGT CACTCATTTT GTACCCAAAG GTGTGTTTCA GTTTCACTCA ATTGGGGGCA CTTGGAATGA
TTAAACAATG AATTTGAATA TAATGATTAA TCATATAAAT GTGATTGTTT AGGCGAATTC AAAATACGAA ATTGGACTTG
GAGGTATCGC CTCGGAATAG ATGTTGCTAT TTTTAGTTAT ATGGGCGAGC TCAAGTTATA ATGGTTTATA TGTTTTCCTG
TATTTTTTGT TAGTTTTGTA CAAAAACCAA TCCTACCTGG ATTTTTTTTT TTTGGGATGG AGGGAGTATT GATTTACCTG
TTAGTATGTT GGTAGCTTGG AAACCTAAGT TCTATAATTA TGCTCAAATG TGTGTAATGC CTAATCAGCT TAAGATGGTC
ATGTATTCAT CTTGAACTTC TATCGGCAGT GAGGCAGTCT GAGTGATGGG AAGGAATCAA CTAGTAAATC TTTTTCTTAT
AGTGCACCAT TCTAAACTTG AAATGGTTTT GTGTTACCAT ACTTAGCACT TATCCACTGT TGATTAAGAT AAAGTTTTCT
GGCATCACCA ATTGCTAATT TGAGTCAGGT TTAACATATC CTCACTCACC TATGCATGTG TAGGGACATA ATAAATACAT
GGTTTGTCAC AGAGACAGGA CCTAAGTTAA ACAACACCTG AATGCTCAGG GTCCATAATG GCATAATGTA GCTTACATTT
TATTTACATA GTAAATGGAT TACTAAATTT CACTTTTCGG GTCAATGCAA CAGGTCTTGA GGAAGTTGGT GGACGATGCA
TCTAAGTTTT TGAATGACAA AATTACCAAA GCAGTGGTTA CTGTTCCTGC ATACTTCAAT GACTCACAGA GGACAGCAAC
AAAAGATGCT GGACGTATTG CAGGATtgga agttctccgc attataaatg agccgactgc tgcatccctt gcttatggtt
ttgagaagaa aaacaacgaa acgattcttg tgtttgactt gggaggcggt acctttgatg tctctggtat GTTATGTGCT
AGAACACCAA ACTGTTTACT TTTCTTGCAC TATTACTGTA GCATAGGGAT CTCGTGGACC TGAATCTTAT CATACTTCTA
TGACAGACCT TTTTTCCTAG ATGGATCGTA CTGGAAAATA GATGATGAAT TGATTTGATC AAATGGAATG TGAAATGCTG
TTGCTGTTTC ATATCTGTGA AATCTTTTAC CAAGGTTCAC AACTGTTTAG CCAGAAACAT GAGTTCTTTA TATGGTTCCT
CCAGAACTTA ATATATTGTC TTTTATGAAG GTTCAGAACT ATTTAGCCAC AAGCATGAGT TCTACTTTAT ATGGTCCCTC
CTGAATTAAA CATATCGTTA CTAAATATTT GAGTTGAGTA GCTCCTTGTT CTATCATCAT ACATATAGAG GCTGCCTCGA
GTTTTTTTAA ATAGATCAAT ATTTAGTTAA AAGGGACTTT GGAAGAGAGA TACTCAAAGC AGATTTTTCT GCGAAAATGA
CTTTGGAAGA ATGAAACTTA CTTCAGGAGT CCCTCAATTG TGAAGTATAT GGTTCATGTT GTGATGAAAA AAATAGGATG
AGTCCTCAAA CATGCCATGA TGTAATTGAA TTGTGATCTC TACTAAAGAA ACATTATCCT GCAGTATTGG AGGTTGGAGA
TGGTGTGTTT GAGGTGCTTT CCACATCTGG TGACACACAC CTTGGTGGCG ATGACTTCGA TAAGGTATGT AATTCCATTT
TTATTTTTAA GAGATTAACT ACTGCCGAAT CTCCATTTTG GAATTTCGTG AAAATACATC GCAACTGTTC GAACTGTTTT
CTATGGAATG TTGCACTATG CATTTTTGAC AAATATTATA TGATGTGGTG CCTCTTATGT GTATTACATT ATTCTTTCTT
TGGTAAACTC ACAATATCAG TCAACCAAAA TTTCTCAATA GGTTGCTCGT TCTATATAAT TATGTTATTG CAGTTTTATT
TCTGTTGGGT ATTTTACTTT GGAGCCATGA CTCATGAAAC TCCTGTAAGT ATGAGCTCTG TGTGTTTTGT GCTGGAATCT
GACCTCTTCA AGCCTTCCAT ATATTCTTTA TGTAATGCCC ATGACCTAAA AATATGTAAT TTGAACTTTT GAAAGTCAAC
TTAGGCTTCg ttcgttcccg ggtgatctgg gagattgaga gagaaaacat ctcgttttcc gcgcgcacgc ttcccaaact
attaaatggt gcgttttttg caaaaaaaat tccataagaa agttgcttta aaaaatcata ttaatccatt tttaaaattt
aaaatagtta atactcaact aatcatacgc taatggctca cctcgttttg tgtatctttc caatcttccc aatctcctca
atccccttct cctcaaacac acccTTAGCA TATCAAAGGT CTATTGGCAT TGTAGTGTAG CTCCATGGAC AACATACCTA
TCAGTTGAAC TGATTCTTTT ACTGACAGTA TGCTATATTT ATTGTTTTTT TTTAATTTGA ATGTTATCCT TGAATTATGT
AGAAAGTTGT GGATTGGCTT GCTAGCAACT TTAAGAAAGA TGAAGGCATT GATCTTCTGA AAGACAAACA AGCCCTGCAG
CGACTCACTG AGGCAGCAGA GAAAGCGAAG ATGGAACTGT CTACGCTGTC TCAGACAAAC ATTAGGTGAG CTTCTTTCCA
ATTGTTCTCA CAGAGTATTC TATTGCTCAT TTGGTGATTT TTCTTCTTAA ATAATTGAAT GTCTTGAATT GCAGCTTGCC
TTTCATAACT GCTACTGCTG ATGGGCCTAA ACACATCGAG ACAACTCTCT CCAGAGCCAA ATTTGAGGAG CTATGTTCGG
ACCTCATTGA TAGGTAAAAT ATGGACATTC TGCTGATATA TAAGCCTATT GCTTAGGAAA ATGATTTGCA TTTTCTCAAA
TTTTTTTAAG GCTTGACTAA TATGTTTCTT ATTGATAGGC TTAAAACTCC TGTCACTAAT GCCTTGAGAG ATGCCAAACT
GTCTGTTGAT AACCTGGACG AAGTGATTCT TGTTGGTGGA TCCACTCGTA TCCCTTCCGT GCAAGAGCTT GTGAAGAAGA
TCACTGGCAA GGATCCCAAT GTCACAGTCA ACCCTGATGA GGTTGTTTCT CTTGGGGCAG CTGTACAGGT CACTTTCTTG
TCCTCACAAG TGCTTTAATT TGTTGTTCTT TGCAGAAAAT CATCCATAAA CCTTCTAATT ACTTCACTGA TCTTAAGTGC
ATGTTTCCTG CATTATAGTG GATCACAAAT CAATTTATAT GTATTTAAAA CTAACTGCCC AAAGCGTGTT TTAACACTGC
CAAGACTGCA TTTATCTTGT TCCGAATCTG AAATCTCAAA TCAATATATT TTGTGTTTCC CTTGTAACAC CAGGGTGGAG
TTTTGGCCGG AGATGTGAAA GATGTCGTTC TTCTTGATGT TACTCCATTG TCTCTTGGTC TGGAGACGTT GGGTGGAGTG
ATGACCAAGA TTATTCCCAG AAACACAACA CTGCCCACCT CAAAATCAGA GGTATTCTCC ACAGCTGCAG ATGGACAGAC
AAGTGTTGAG ATAAATGTTC TTCAGGGAGA GAGAGAGTTT GTCCGGGACA ACAAGTCTCT TGGAAGCTTC CGCTTGGATG
GAATCCCTCC TGCACCACGT GGTGTTCCAC AAATTGAAGT CAAGTTTGAT ATTGATGCCA ATGGTATTCT CTCTGTTGCT
GCTATTGATA AGGGTACTGG GAAGAAACAG GATATCACCA TCACCGGCGC TAGTACACTG CCAAAGGATG AGGTATGTTC
CCACCTTATT TGCTTAAGCA TTGTGTGATT ACATTCATCA AAAGTTGGTT GCCAGCTTGC TATATTGCAA CTAGGTACAA
AGTTGGCAAG TTTCTTCTTA ACGTATGATA GTTTTCTGCA TGGTTATCTA GTTGTAGATT TTCTTTTCCA CCATATGTTG
TGCAGCTTCT TTCTTTGATT CCCAATCCCG TTATTTGCTA CTGGTGTGAA ATTTATTTAC CAAATTTCTT CTATTATGGT
AGAGTTTTTC ATATCTTTAC CAGATCGCAT GTATTGACTA TTTGTTTGCA TATAATCTAT GTTGATGGAA GAGTAATTGA
ATTTTTTGTG GTATAGAGTT TAGGTATCAG TTCCTCTAGG GAAACAACAC TATGCTCCTG TAAGCGAAGA TACAAATGCC
TACATTGAAG CATAACATTC AATCTGAAAC AACATTTTGT GTTTGTAGGT TGAGAGAATG GTGGAAGAGG CTGACAAGTT
TGCTCAGGAG GACAAAGAGA AAAGAGATGC CATTGATACC AAAAACCAGG CAGACTCTGT GGTCTACCAG ACTGAGAAGC
AACTGAAGGA GCTAGGTGAC AAGGTACCTG CACCTGTGAA AGAGAAGGTG GATGCAAAGC TCAACGAGCT CAAAGAGGCC
ATTGCGGGTG GATCAACACA GAGCATGAAG GATGCCATGG CTGCTTTAAA CGAGGAAGTT ATGCAGATCG GCCAGGCCAT
GTACAACCAG CAGCCTAATG CTGGTGCTGC TGGACCTACT CCTGGTGCCG ATGCTGGACC GACAAGCTCA GGCGGTAAGG
GACCGAATGA TGGAGATGTT ATTGATGCGG ATTTCACTGA CAGCAATTGA TAGTTCTAGC GATTGAAGAT TATTGATGGA
AGGATGATCT GTGGTGGATG GCTGTGAGGG TCTGATGGGT GATGGTATAG GAAGAAGGGA GTGAACAAAT TGTTCTTTTT
GTTTACTATG GATCCCATGT TCAATAGGCT CTTTAGTTTG CAATTTGATA GCGTAGGGTT TTGCCAACAT TTTCCTGTGA
TGTTGAATGA AGGATTATAA AAAGTAGCCT TCAAAAAAAG AGGAGGCAAA GGTTTTGATC GAAGAAGTAG CTGATTGATA
TGACCTTGTT CCTTGAAAAT AAAAATATCA TTAGTTCC

Locus: Os12g0244100

Loading...

Locus: Os12g0244100

Loading...