Os12t0244100-03

Locus

Os12g0244100

Description

Similar to stromal 70 kDa heat shock-related protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSP70CP2

CGSNL Gene Name

HEAT SHOCK PROTEIN 70KD CHLOROPLAST PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsHsp70CP2

Oryzabase Gene Name Synonym(s)

heat shock protein 70 chloroplast protein 2

Transcript Evidence

AK119535 (DDBJ, Best hit)

Protein Evidence

D3YE92 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Heat shock protein 70, conserved site (IPR018181)

Full-length cDNA

001-204-B03 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0244100-03)

RiceXPro (AK119535)

Others

Oryzabase (13067)

KEGG (Os12t0244100-03)

Transcript

1667 bp

>Os12t0244100-03 Similar to stromal 70 kDa heat shock-related protein.
gagaagaaaaacaacgaaacgattcttgtgtttgacttgggaggcggtacctttgatgtc
tctgTATTGGAGGTTGGAGATGGTGTGTTTGAGGTGCTTTCCACATCTGGTGACACACAC
CTTGGTGGCGATGACTTCGATAAGAAAGTTGTGGATTGGCTTGCTAGCAACTTTAAGAAA
GATGAAGGCATTGATCTTCTGAAAGACAAACAAGCCCTGCAGCGACTCACTGAGGCAGCA
GAGAAAGCGAAGATGGAACTGTCTACGCTGTCTCAGACAAACATTAGCTTGCCTTTCATA
ACTGCTACTGCTGATGGGCCTAAACACATCGAGACAACTCTCTCCAGAGCCAAATTTGAG
GAGCTATGTTCGGACCTCATTGATAGGCTTAAAACTCCTGTCACTAATGCCTTGAGAGAT
GCCAAACTGTCTGTTGATAACCTGGACGAAGTGATTCTTGTTGGTGGATCCACTCGTATC
CCTTCCGTGCAAGAGCTTGTGAAGAAGATCACTGGCAAGGATCCCAATGTCACAGTCAAC
CCTGATGAGGTTGTTTCTCTTGGGGCAGCTGTACAGGGTGGAGTTTTGGCCGGAGATGTG
AAAGATGTCGTTCTTCTTGATGTTACTCCATTGTCTCTTGGTCTGGAGACGTTGGGTGGA
GTGATGACCAAGATTATTCCCAGAAACACAACACTGCCCACCTCAAAATCAGAGGTATTC
TCCACAGCTGCAGATGGACAGACAAGTGTTGAGATAAATGTTCTTCAGGGAGAGAGAGAG
TTTGTCCGGGACAACAAGTCTCTTGGAAGCTTCCGCTTGGATGGAATCCCTCCTGCACCA
CGTGGTGTTCCACAAATTGAAGTCAAGTTTGATATTGATGCCAATGGTATTCTCTCTGTT
GCTGCTATTGATAAGGGTACTGGGAAGAAACAGGATATCACCATCACCGGCGCTAGTACA
CTGCCAAAGGATGAGGTTGAGAGAATGGTGGAAGAGGCTGACAAGTTTGCTCAGGAGGAC
AAAGAGAAAAGAGATGCCATTGATACCAAAAACCAGGCAGACTCTGTGGTCTACCAGACT
GAGAAGCAACTGAAGGAGCTAGGTGACAAGGTACCTGCACCTGTGAAAGAGAAGGTGGAT
GCAAAGCTCAACGAGCTCAAAGAGGCCATTGCGGGTGGATCAACACAGAGCATGAAGGAT
GCCATGGCTGCTTTAAACGAGGAAGTTATGCAGATCGGCCAGGCCATGTACAACCAGCAG
CCTAATGCTGGTGCTGCTGGACCTACTCCTGGTGCCGATGCTGGACCGACAAGCTCAGGC
GGTAAGGGACCGAATGATGGAGATGTTATTGATGCGGATTTCACTGACAGCAATTGATAG
TTCTAGCGATTGAAGATTATTGATGGAAGGATGATCTGTGGTGGATGGCTGTGAGGGTCT
GATGGGTGATGGTATAGGAAGAAGGGAGTGAACAAATTGTTCTTTTTGTTTACTATGGAT
CCCATGTTCAATAGGCTCTTTAGTTTGCAATTTGATAGCGTAGGGTTTTGCCAACATTTT
CCTGTGATGTTGAATGAAGGATTATAAAAAGTAGCCTTCAAAAAAAGAGGAGGCAAAGGT
TTTGATCGAAGAAGTAGCTGATTGATATGACCTTGTTCCTTGAAAAT

CDS

1377 bp

>Os12t0244100-03 Similar to stromal 70 kDa heat shock-related protein.
gagaagaaaaacaacgaaacgattcttgtgtttgacttgggaggcggtacctttgatgtc
tctgTATTGGAGGTTGGAGATGGTGTGTTTGAGGTGCTTTCCACATCTGGTGACACACAC
CTTGGTGGCGATGACTTCGATAAGAAAGTTGTGGATTGGCTTGCTAGCAACTTTAAGAAA
GATGAAGGCATTGATCTTCTGAAAGACAAACAAGCCCTGCAGCGACTCACTGAGGCAGCA
GAGAAAGCGAAGATGGAACTGTCTACGCTGTCTCAGACAAACATTAGCTTGCCTTTCATA
ACTGCTACTGCTGATGGGCCTAAACACATCGAGACAACTCTCTCCAGAGCCAAATTTGAG
GAGCTATGTTCGGACCTCATTGATAGGCTTAAAACTCCTGTCACTAATGCCTTGAGAGAT
GCCAAACTGTCTGTTGATAACCTGGACGAAGTGATTCTTGTTGGTGGATCCACTCGTATC
CCTTCCGTGCAAGAGCTTGTGAAGAAGATCACTGGCAAGGATCCCAATGTCACAGTCAAC
CCTGATGAGGTTGTTTCTCTTGGGGCAGCTGTACAGGGTGGAGTTTTGGCCGGAGATGTG
AAAGATGTCGTTCTTCTTGATGTTACTCCATTGTCTCTTGGTCTGGAGACGTTGGGTGGA
GTGATGACCAAGATTATTCCCAGAAACACAACACTGCCCACCTCAAAATCAGAGGTATTC
TCCACAGCTGCAGATGGACAGACAAGTGTTGAGATAAATGTTCTTCAGGGAGAGAGAGAG
TTTGTCCGGGACAACAAGTCTCTTGGAAGCTTCCGCTTGGATGGAATCCCTCCTGCACCA
CGTGGTGTTCCACAAATTGAAGTCAAGTTTGATATTGATGCCAATGGTATTCTCTCTGTT
GCTGCTATTGATAAGGGTACTGGGAAGAAACAGGATATCACCATCACCGGCGCTAGTACA
CTGCCAAAGGATGAGGTTGAGAGAATGGTGGAAGAGGCTGACAAGTTTGCTCAGGAGGAC
AAAGAGAAAAGAGATGCCATTGATACCAAAAACCAGGCAGACTCTGTGGTCTACCAGACT
GAGAAGCAACTGAAGGAGCTAGGTGACAAGGTACCTGCACCTGTGAAAGAGAAGGTGGAT
GCAAAGCTCAACGAGCTCAAAGAGGCCATTGCGGGTGGATCAACACAGAGCATGAAGGAT
GCCATGGCTGCTTTAAACGAGGAAGTTATGCAGATCGGCCAGGCCATGTACAACCAGCAG
CCTAATGCTGGTGCTGCTGGACCTACTCCTGGTGCCGATGCTGGACCGACAAGCTCAGGC
GGTAAGGGACCGAATGATGGAGATGTTATTGATGCGGATTTCACTGACAGCAATTGA

Protein

459 aa

>Os12t0244100-03 Similar to stromal 70 kDa heat shock-related protein.
EKKNNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKKVVDWLASNFKK
DEGIDLLKDKQALQRLTEAAEKAKMELSTLSQTNISLPFITATADGPKHIETTLSRAKFE
ELCSDLIDRLKTPVTNALRDAKLSVDNLDEVILVGGSTRIPSVQELVKKITGKDPNVTVN
PDEVVSLGAAVQGGVLAGDVKDVVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVF
STAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSV
AAIDKGTGKKQDITITGASTLPKDEVERMVEEADKFAQEDKEKRDAIDTKNQADSVVYQT
EKQLKELGDKVPAPVKEKVDAKLNELKEAIAGGSTQSMKDAMAALNEEVMQIGQAMYNQQ
PNAGAAGPTPGADAGPTSSGGKGPNDGDVIDADFTDSN*

CDS

chr12:7987807..7987870 (+ strand) : 64 bp

chr12:7988509..7988588 (+ strand) : 80 bp

chr12:7989407..7989549 (+ strand) : 143 bp

chr12:7989639..7989737 (+ strand) : 99 bp

chr12:7989843..7990032 (+ strand) : 190 bp

chr12:7990278..7990676 (+ strand) : 399 bp

chr12:7991133..7991534 (+ strand) : 402 bp

3'UTR

chr12:7991535..7991824 (+ strand) : 290 bp

FASTA

>Os12t0244100-03 class=Sequence position=chr12:7987807..7991824 (+ strand)
gagaagaaaa acaacgaaac gattcttgtg tttgacttgg gaggcggtac ctttgatgtc tctggtatGT TATGTGCTAG
AACACCAAAC TGTTTACTTT TCTTGCACTA TTACTGTAGC ATAGGGATCT CGTGGACCTG AATCTTATCA TACTTCTATG
ACAGACCTTT TTTCCTAGAT GGATCGTACT GGAAAATAGA TGATGAATTG ATTTGATCAA ATGGAATGTG AAATGCTGTT
GCTGTTTCAT ATCTGTGAAA TCTTTTACCA AGGTTCACAA CTGTTTAGCC AGAAACATGA GTTCTTTATA TGGTTCCTCC
AGAACTTAAT ATATTGTCTT TTATGAAGGT TCAGAACTAT TTAGCCACAA GCATGAGTTC TACTTTATAT GGTCCCTCCT
GAATTAAACA TATCGTTACT AAATATTTGA GTTGAGTAGC TCCTTGTTCT ATCATCATAC ATATAGAGGC TGCCTCGAGT
TTTTTTAAAT AGATCAATAT TTAGTTAAAA GGGACTTTGG AAGAGAGATA CTCAAAGCAG ATTTTTCTGC GAAAATGACT
TTGGAAGAAT GAAACTTACT TCAGGAGTCC CTCAATTGTG AAGTATATGG TTCATGTTGT GATGAAAAAA ATAGGATGAG
TCCTCAAACA TGCCATGATG TAATTGAATT GTGATCTCTA CTAAAGAAAC ATTATCCTGC AGTATTGGAG GTTGGAGATG
GTGTGTTTGA GGTGCTTTCC ACATCTGGTG ACACACACCT TGGTGGCGAT GACTTCGATA AGGTATGTAA TTCCATTTTT
ATTTTTAAGA GATTAACTAC TGCCGAATCT CCATTTTGGA ATTTCGTGAA AATACATCGC AACTGTTCGA ACTGTTTTCT
ATGGAATGTT GCACTATGCA TTTTTGACAA ATATTATATG ATGTGGTGCC TCTTATGTGT ATTACATTAT TCTTTCTTTG
GTAAACTCAC AATATCAGTC AACCAAAATT TCTCAATAGG TTGCTCGTTC TATATAATTA TGTTATTGCA GTTTTATTTC
TGTTGGGTAT TTTACTTTGG AGCCATGACT CATGAAACTC CTGTAAGTAT GAGCTCTGTG TGTTTTGTGC TGGAATCTGA
CCTCTTCAAG CCTTCCATAT ATTCTTTATG TAATGCCCAT GACCTAAAAA TATGTAATTT GAACTTTTGA AAGTCAACTT
AGGCTTCgtt cgttcccggg tgatctggga gattgagaga gaaaacatct cgttttccgc gcgcacgctt cccaaactat
taaatggtgc gttttttgca aaaaaaattc cataagaaag ttgctttaaa aaatcatatt aatccatttt taaaatttaa
aatagttaat actcaactaa tcatacgcta atggctcacc tcgttttgtg tatctttcca atcttcccaa tctcctcaat
ccccttctcc tcaaacacac ccTTAGCATA TCAAAGGTCT ATTGGCATTG TAGTGTAGCT CCATGGACAA CATACCTATC
AGTTGAACTG ATTCTTTTAC TGACAGTATG CTATATTTAT TGTTTTTTTT TAATTTGAAT GTTATCCTTG AATTATGTAG
AAAGTTGTGG ATTGGCTTGC TAGCAACTTT AAGAAAGATG AAGGCATTGA TCTTCTGAAA GACAAACAAG CCCTGCAGCG
ACTCACTGAG GCAGCAGAGA AAGCGAAGAT GGAACTGTCT ACGCTGTCTC AGACAAACAT TAGGTGAGCT TCTTTCCAAT
TGTTCTCACA GAGTATTCTA TTGCTCATTT GGTGATTTTT CTTCTTAAAT AATTGAATGT CTTGAATTGC AGCTTGCCTT
TCATAACTGC TACTGCTGAT GGGCCTAAAC ACATCGAGAC AACTCTCTCC AGAGCCAAAT TTGAGGAGCT ATGTTCGGAC
CTCATTGATA GGTAAAATAT GGACATTCTG CTGATATATA AGCCTATTGC TTAGGAAAAT GATTTGCATT TTCTCAAATT
TTTTTAAGGC TTGACTAATA TGTTTCTTAT TGATAGGCTT AAAACTCCTG TCACTAATGC CTTGAGAGAT GCCAAACTGT
CTGTTGATAA CCTGGACGAA GTGATTCTTG TTGGTGGATC CACTCGTATC CCTTCCGTGC AAGAGCTTGT GAAGAAGATC
ACTGGCAAGG ATCCCAATGT CACAGTCAAC CCTGATGAGG TTGTTTCTCT TGGGGCAGCT GTACAGGTCA CTTTCTTGTC
CTCACAAGTG CTTTAATTTG TTGTTCTTTG CAGAAAATCA TCCATAAACC TTCTAATTAC TTCACTGATC TTAAGTGCAT
GTTTCCTGCA TTATAGTGGA TCACAAATCA ATTTATATGT ATTTAAAACT AACTGCCCAA AGCGTGTTTT AACACTGCCA
AGACTGCATT TATCTTGTTC CGAATCTGAA ATCTCAAATC AATATATTTT GTGTTTCCCT TGTAACACCA GGGTGGAGTT
TTGGCCGGAG ATGTGAAAGA TGTCGTTCTT CTTGATGTTA CTCCATTGTC TCTTGGTCTG GAGACGTTGG GTGGAGTGAT
GACCAAGATT ATTCCCAGAA ACACAACACT GCCCACCTCA AAATCAGAGG TATTCTCCAC AGCTGCAGAT GGACAGACAA
GTGTTGAGAT AAATGTTCTT CAGGGAGAGA GAGAGTTTGT CCGGGACAAC AAGTCTCTTG GAAGCTTCCG CTTGGATGGA
ATCCCTCCTG CACCACGTGG TGTTCCACAA ATTGAAGTCA AGTTTGATAT TGATGCCAAT GGTATTCTCT CTGTTGCTGC
TATTGATAAG GGTACTGGGA AGAAACAGGA TATCACCATC ACCGGCGCTA GTACACTGCC AAAGGATGAG GTATGTTCCC
ACCTTATTTG CTTAAGCATT GTGTGATTAC ATTCATCAAA AGTTGGTTGC CAGCTTGCTA TATTGCAACT AGGTACAAAG
TTGGCAAGTT TCTTCTTAAC GTATGATAGT TTTCTGCATG GTTATCTAGT TGTAGATTTT CTTTTCCACC ATATGTTGTG
CAGCTTCTTT CTTTGATTCC CAATCCCGTT ATTTGCTACT GGTGTGAAAT TTATTTACCA AATTTCTTCT ATTATGGTAG
AGTTTTTCAT ATCTTTACCA GATCGCATGT ATTGACTATT TGTTTGCATA TAATCTATGT TGATGGAAGA GTAATTGAAT
TTTTTGTGGT ATAGAGTTTA GGTATCAGTT CCTCTAGGGA AACAACACTA TGCTCCTGTA AGCGAAGATA CAAATGCCTA
CATTGAAGCA TAACATTCAA TCTGAAACAA CATTTTGTGT TTGTAGGTTG AGAGAATGGT GGAAGAGGCT GACAAGTTTG
CTCAGGAGGA CAAAGAGAAA AGAGATGCCA TTGATACCAA AAACCAGGCA GACTCTGTGG TCTACCAGAC TGAGAAGCAA
CTGAAGGAGC TAGGTGACAA GGTACCTGCA CCTGTGAAAG AGAAGGTGGA TGCAAAGCTC AACGAGCTCA AAGAGGCCAT
TGCGGGTGGA TCAACACAGA GCATGAAGGA TGCCATGGCT GCTTTAAACG AGGAAGTTAT GCAGATCGGC CAGGCCATGT
ACAACCAGCA GCCTAATGCT GGTGCTGCTG GACCTACTCC TGGTGCCGAT GCTGGACCGA CAAGCTCAGG CGGTAAGGGA
CCGAATGATG GAGATGTTAT TGATGCGGAT TTCACTGACA GCAATTGATA GTTCTAGCGA TTGAAGATTA TTGATGGAAG
GATGATCTGT GGTGGATGGC TGTGAGGGTC TGATGGGTGA TGGTATAGGA AGAAGGGAGT GAACAAATTG TTCTTTTTGT
TTACTATGGA TCCCATGTTC AATAGGCTCT TTAGTTTGCA ATTTGATAGC GTAGGGTTTT GCCAACATTT TCCTGTGATG
TTGAATGAAG GATTATAAAA AGTAGCCTTC AAAAAAAGAG GAGGCAAAGG TTTTGATCGA AGAAGTAGCT GATTGATATG
ACCTTGTTCC TTGAAAAT

Locus: Os12g0244100

Loading...

Locus: Os12g0244100

Loading...