Os12t0244100-04

Locus

Os12g0244100

Description

Similar to stromal 70 kDa heat shock-related protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

HSP70CP2

CGSNL Gene Name

HEAT SHOCK PROTEIN 70KD CHLOROPLAST PROTEIN 2

Oryzabase Gene Symbol Synonym(s)

OsHsp70CP2

Oryzabase Gene Name Synonym(s)

heat shock protein 70 chloroplast protein 2

Transcript Evidence

AK069937 (DDBJ, Best hit)

Protein Evidence

D3YE92 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: ATP binding (GO:0005524)

Functional domain (InterPro)

Heat shock protein Hsp70 (IPR001023)

Heat shock protein 70 (IPR013126)

Heat shock protein 70, conserved site (IPR018181)

Full-length cDNA

J023038F19 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0244100-04)

RiceXPro (AK069937)

Others

Oryzabase (13067)

KEGG (Os12t0244100-04)

Transcript

1293 bp

>Os12t0244100-04 Similar to stromal 70 kDa heat shock-related protein.
TGTCACTAATGCCTTGAGAGATGCCAAACTGTCTGTTGATAACCTGGACGAAGTGATTCT
TGTTGGTGGATCCACTCGTATCCCTTCCGTGCAAGAGCTTGTGAAGAAGATCACTGGCAA
GGATCCCAATGTCACAGTCAACCCTGATGAGGTTGTTTCTCTTGGGGCAGCTGTACAGGG
TGGAGTTTTGGCCGGAGATGTGAAAGATGTCGTTCTTCTTGATGTTACTCCATTGTCTCT
TGGTCTGGAGACGTTGGGTGGAGTGATGACCAAGATTATTCCCAGAAACACAACACTGCC
CACCTCAAAATCAGAGGTATTCTCCACAGCTGCAGATGGACAGACAAGTGTTGAGATAAA
TGTTCTTCAGGGAGAGAGAGAGTTTGTCCGGGACAACAAGTCTCTTGGAAGCTTCCGCTT
GGATGGAATCCCTCCTGCACCACGTGGTGTTCCACAAATTGAAGTCAAGTTTGATATTGA
TGCCAATGGTATTCTCTCTGTTGCTGCTATTGATAAGGGTACTGGGAAGAAACAGGATAT
CACCATCACCGGCGCTAGTACACTGCCAAAGGATGAGGTTGAGAGAATGGTGGAAGAGGC
TGACAAGTTTGCTCAGGAGGACAAAGAGAAAAGAGATGCCATTGATACCAAAAACCAGGC
AGACTCTGTGGTCTACCAGACTGAGAAGCAACTGAAGGAGCTAGGTGACAAGGTACCTGC
ACCTGTGAAAGAGAAGGTGGATGCAAAGCTCAACGAGCTCAAAGAGGCCATTGCGGGTGG
ATCAACACAGAGCATGAAGGATGCCATGGCTGCTTTAAACGAGGAAGTTATGCAGATCGG
CCAGGCCATGTACAACCAGCAGCCTAATGCTGGTGCTGCTGGACCTACTCCTGGTGCCGA
TGCTGGACCGACAAGCTCAGGCGGTAAGGGACCGAATGATGGAGATGTTATTGATGCGGA
TTTCACTGACAGCAATTGATAGTTCTAGCGATTGAAGATTATTGATGGAAGGATGATCTG
TGGTGGATGGCTGTGAGGGTCTGATGGGTGATGGTATAGGAAGAAGGGAGTGAACAAATT
GTTCTTTTTGTTTACTATGGATCCCATGTTCAATAGGCTCTTTAGTTTGCAATTTGATAG
CGTAGGGTTTTGCCAACATTTTCCTGTGATGTTGAATGAAGGATTATAAAAAGTAGCCTT
CAAAAAAAGAGGAGGCAAAGGTTTTGATCGAAGAAGTAGCTGATTGATATGACCTTGTTC
CTTGAAAATAAAAATATCATTAGTTCCCTGTGC

CDS

978 bp

>Os12t0244100-04 Similar to stromal 70 kDa heat shock-related protein.
GTCACTAATGCCTTGAGAGATGCCAAACTGTCTGTTGATAACCTGGACGAAGTGATTCTT
GTTGGTGGATCCACTCGTATCCCTTCCGTGCAAGAGCTTGTGAAGAAGATCACTGGCAAG
GATCCCAATGTCACAGTCAACCCTGATGAGGTTGTTTCTCTTGGGGCAGCTGTACAGGGT
GGAGTTTTGGCCGGAGATGTGAAAGATGTCGTTCTTCTTGATGTTACTCCATTGTCTCTT
GGTCTGGAGACGTTGGGTGGAGTGATGACCAAGATTATTCCCAGAAACACAACACTGCCC
ACCTCAAAATCAGAGGTATTCTCCACAGCTGCAGATGGACAGACAAGTGTTGAGATAAAT
GTTCTTCAGGGAGAGAGAGAGTTTGTCCGGGACAACAAGTCTCTTGGAAGCTTCCGCTTG
GATGGAATCCCTCCTGCACCACGTGGTGTTCCACAAATTGAAGTCAAGTTTGATATTGAT
GCCAATGGTATTCTCTCTGTTGCTGCTATTGATAAGGGTACTGGGAAGAAACAGGATATC
ACCATCACCGGCGCTAGTACACTGCCAAAGGATGAGGTTGAGAGAATGGTGGAAGAGGCT
GACAAGTTTGCTCAGGAGGACAAAGAGAAAAGAGATGCCATTGATACCAAAAACCAGGCA
GACTCTGTGGTCTACCAGACTGAGAAGCAACTGAAGGAGCTAGGTGACAAGGTACCTGCA
CCTGTGAAAGAGAAGGTGGATGCAAAGCTCAACGAGCTCAAAGAGGCCATTGCGGGTGGA
TCAACACAGAGCATGAAGGATGCCATGGCTGCTTTAAACGAGGAAGTTATGCAGATCGGC
CAGGCCATGTACAACCAGCAGCCTAATGCTGGTGCTGCTGGACCTACTCCTGGTGCCGAT
GCTGGACCGACAAGCTCAGGCGGTAAGGGACCGAATGATGGAGATGTTATTGATGCGGAT
TTCACTGACAGCAATTGA

Protein

326 aa

>Os12t0244100-04 Similar to stromal 70 kDa heat shock-related protein.
VTNALRDAKLSVDNLDEVILVGGSTRIPSVQELVKKITGKDPNVTVNPDEVVSLGAAVQG
GVLAGDVKDVVLLDVTPLSLGLETLGGVMTKIIPRNTTLPTSKSEVFSTAADGQTSVEIN
VLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVKFDIDANGILSVAAIDKGTGKKQDI
TITGASTLPKDEVERMVEEADKFAQEDKEKRDAIDTKNQADSVVYQTEKQLKELGDKVPA
PVKEKVDAKLNELKEAIAGGSTQSMKDAMAALNEEVMQIGQAMYNQQPNAGAAGPTPGAD
AGPTSSGGKGPNDGDVIDADFTDSN*

5'UTR

chr12:7989855..7989855 (+ strand) : 1 bp

CDS

chr12:7989856..7990032 (+ strand) : 177 bp

chr12:7990278..7990676 (+ strand) : 399 bp

chr12:7991133..7991534 (+ strand) : 402 bp

3'UTR

chr12:7991535..7991848 (+ strand) : 314 bp

FASTA

>Os12t0244100-04 class=Sequence position=chr12:7989855..7991848 (+ strand)
TGTCACTAAT GCCTTGAGAG ATGCCAAACT GTCTGTTGAT AACCTGGACG AAGTGATTCT TGTTGGTGGA TCCACTCGTA
TCCCTTCCGT GCAAGAGCTT GTGAAGAAGA TCACTGGCAA GGATCCCAAT GTCACAGTCA ACCCTGATGA GGTTGTTTCT
CTTGGGGCAG CTGTACAGGT CACTTTCTTG TCCTCACAAG TGCTTTAATT TGTTGTTCTT TGCAGAAAAT CATCCATAAA
CCTTCTAATT ACTTCACTGA TCTTAAGTGC ATGTTTCCTG CATTATAGTG GATCACAAAT CAATTTATAT GTATTTAAAA
CTAACTGCCC AAAGCGTGTT TTAACACTGC CAAGACTGCA TTTATCTTGT TCCGAATCTG AAATCTCAAA TCAATATATT
TTGTGTTTCC CTTGTAACAC CAGGGTGGAG TTTTGGCCGG AGATGTGAAA GATGTCGTTC TTCTTGATGT TACTCCATTG
TCTCTTGGTC TGGAGACGTT GGGTGGAGTG ATGACCAAGA TTATTCCCAG AAACACAACA CTGCCCACCT CAAAATCAGA
GGTATTCTCC ACAGCTGCAG ATGGACAGAC AAGTGTTGAG ATAAATGTTC TTCAGGGAGA GAGAGAGTTT GTCCGGGACA
ACAAGTCTCT TGGAAGCTTC CGCTTGGATG GAATCCCTCC TGCACCACGT GGTGTTCCAC AAATTGAAGT CAAGTTTGAT
ATTGATGCCA ATGGTATTCT CTCTGTTGCT GCTATTGATA AGGGTACTGG GAAGAAACAG GATATCACCA TCACCGGCGC
TAGTACACTG CCAAAGGATG AGGTATGTTC CCACCTTATT TGCTTAAGCA TTGTGTGATT ACATTCATCA AAAGTTGGTT
GCCAGCTTGC TATATTGCAA CTAGGTACAA AGTTGGCAAG TTTCTTCTTA ACGTATGATA GTTTTCTGCA TGGTTATCTA
GTTGTAGATT TTCTTTTCCA CCATATGTTG TGCAGCTTCT TTCTTTGATT CCCAATCCCG TTATTTGCTA CTGGTGTGAA
ATTTATTTAC CAAATTTCTT CTATTATGGT AGAGTTTTTC ATATCTTTAC CAGATCGCAT GTATTGACTA TTTGTTTGCA
TATAATCTAT GTTGATGGAA GAGTAATTGA ATTTTTTGTG GTATAGAGTT TAGGTATCAG TTCCTCTAGG GAAACAACAC
TATGCTCCTG TAAGCGAAGA TACAAATGCC TACATTGAAG CATAACATTC AATCTGAAAC AACATTTTGT GTTTGTAGGT
TGAGAGAATG GTGGAAGAGG CTGACAAGTT TGCTCAGGAG GACAAAGAGA AAAGAGATGC CATTGATACC AAAAACCAGG
CAGACTCTGT GGTCTACCAG ACTGAGAAGC AACTGAAGGA GCTAGGTGAC AAGGTACCTG CACCTGTGAA AGAGAAGGTG
GATGCAAAGC TCAACGAGCT CAAAGAGGCC ATTGCGGGTG GATCAACACA GAGCATGAAG GATGCCATGG CTGCTTTAAA
CGAGGAAGTT ATGCAGATCG GCCAGGCCAT GTACAACCAG CAGCCTAATG CTGGTGCTGC TGGACCTACT CCTGGTGCCG
ATGCTGGACC GACAAGCTCA GGCGGTAAGG GACCGAATGA TGGAGATGTT ATTGATGCGG ATTTCACTGA CAGCAATTGA
TAGTTCTAGC GATTGAAGAT TATTGATGGA AGGATGATCT GTGGTGGATG GCTGTGAGGG TCTGATGGGT GATGGTATAG
GAAGAAGGGA GTGAACAAAT TGTTCTTTTT GTTTACTATG GATCCCATGT TCAATAGGCT CTTTAGTTTG CAATTTGATA
GCGTAGGGTT TTGCCAACAT TTTCCTGTGA TGTTGAATGA AGGATTATAA AAAGTAGCCT TCAAAAAAAG AGGAGGCAAA
GGTTTTGATC GAAGAAGTAG CTGATTGATA TGACCTTGTT CCTTGAAAAT AAAAATATCA TTAGTTCCCT GTGC

Locus: Os12g0244100

Loading...

Locus: Os12g0244100

Loading...