Os12t0247700-01

Locus

Os12g0247700

Description

Similar to Jasmonate-induced protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsJAC1, JAC1

Oryzabase Gene Name Synonym(s)

jacalin-related lectin 1

Transcript Evidence

AK066682 (DDBJ, Best hit)

Protein Evidence

Q40007 (UniProt)

Literature

Note

Manual Curation

Functional domain (InterPro)

Mannose-binding lectin (IPR001229)

Plant disease resistance response protein (IPR004265)

Full-length cDNA

J013068M17 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0247700-01)

RiceXPro (AK066682)

Others

Oryzabase (15754)

KEGG (Os12t0247700-01)

Transcript

1203 bp

>Os12t0247700-01 Similar to Jasmonate-induced protein.
TACTCGCAGCGCATCACTCACAGCTACATCCACAAGTACTAAACCAATCTCTGCCAGCAG
TAGCTCTCAGCTATGGCTGATCCCAGCAAGCTGCAAATCACACCCTGTGGCATGCTTGTT
CAGGGCAACCAGATCAACTTCACCAAACTCTACCTGCACCACACGCCGGCTGGTCCAGAA
CAAAACCAGTCGGCGGTCACAAGCAATGACAAAAAAACCGGGTTGGGTTGCATTGTCGTT
AACAACTGGTCAGTATATGACGGAATCGGCAGCGACGCCAAGCTTGTTGCCTATGCAAAA
GGCCTCCACGTTTTTGCGGGTGCCTGGCACAACTCCTTCAGCCTAGTGTTCGAGGATGAA
AGGCTTAAGGGGTCCACGCTTCAGGTGATGGGGCTAATTGTCGAAGAAGGTGATTGGGCT
ATTGTTGGGGGCACAGGACAGTTTGCTATGGCAACTGGTGTTATCTTGAAGAAAATGCAA
GAACAAAAACAATACGGAAACATAATAGAGCTCACTATCCATGGGTTTTGTCCTCTCTTA
AAAGGGTCACAGTGCCCTGTCACCAAGATTGGGCCATGGGGTTCATCTCATGAAGGGACA
GTTCAAGACATCACTGAGTCTCCAAAGCGTCTCGAAAGCATCACATTATACCACGGCTGG
TCTGTTGACTCAATCTCGTTTACTTACCTTGACCATGCCGGAGAGAAGCACAAGGCAGGT
CCATGGGGTGGTCCTGGCGGGGATCCCATAATGATTGAATTTGGCAGTTCAGAGTTTCTC
AAGGAAGTTTCTGGAACGTTTGGCCCATATGAGGGCAGCACCGTTATAACATCTATTAAT
TTTATCACCAATAAGCAAACATATGGCCCATTTGGACGACAGGAGGGAACCCCTTTCAGT
GTCCCAGCGCAGAATAACTCCAGTATAGTGGGTTTCTTTGGGCGCAGTGGGAAATACATA
AATGCAGTTGGTGTCTACGTGCAGCCGATCTAACTTGTCAAAATAAGTATTCCGTGTTTG
AGTTTCACGTGTGTTTTCTGCAGTAAACAAATAAGATGGGGGTCCTCCCTATCATTCCTG
TTGTGATGAGTGATGCTTGGTCGCTGGAGTCCTTCTGAATTTACAGTCGTGTCCTATCAG
TTGTTTCTGTCTGTAGTGTGTTGCATGCATCAATAAAGATCTTCATTGAAGGTTGGTTGT
GTG

CDS

921 bp

>Os12t0247700-01 Similar to Jasmonate-induced protein.
ATGGCTGATCCCAGCAAGCTGCAAATCACACCCTGTGGCATGCTTGTTCAGGGCAACCAG
ATCAACTTCACCAAACTCTACCTGCACCACACGCCGGCTGGTCCAGAACAAAACCAGTCG
GCGGTCACAAGCAATGACAAAAAAACCGGGTTGGGTTGCATTGTCGTTAACAACTGGTCA
GTATATGACGGAATCGGCAGCGACGCCAAGCTTGTTGCCTATGCAAAAGGCCTCCACGTT
TTTGCGGGTGCCTGGCACAACTCCTTCAGCCTAGTGTTCGAGGATGAAAGGCTTAAGGGG
TCCACGCTTCAGGTGATGGGGCTAATTGTCGAAGAAGGTGATTGGGCTATTGTTGGGGGC
ACAGGACAGTTTGCTATGGCAACTGGTGTTATCTTGAAGAAAATGCAAGAACAAAAACAA
TACGGAAACATAATAGAGCTCACTATCCATGGGTTTTGTCCTCTCTTAAAAGGGTCACAG
TGCCCTGTCACCAAGATTGGGCCATGGGGTTCATCTCATGAAGGGACAGTTCAAGACATC
ACTGAGTCTCCAAAGCGTCTCGAAAGCATCACATTATACCACGGCTGGTCTGTTGACTCA
ATCTCGTTTACTTACCTTGACCATGCCGGAGAGAAGCACAAGGCAGGTCCATGGGGTGGT
CCTGGCGGGGATCCCATAATGATTGAATTTGGCAGTTCAGAGTTTCTCAAGGAAGTTTCT
GGAACGTTTGGCCCATATGAGGGCAGCACCGTTATAACATCTATTAATTTTATCACCAAT
AAGCAAACATATGGCCCATTTGGACGACAGGAGGGAACCCCTTTCAGTGTCCCAGCGCAG
AATAACTCCAGTATAGTGGGTTTCTTTGGGCGCAGTGGGAAATACATAAATGCAGTTGGT
GTCTACGTGCAGCCGATCTAA

Protein

307 aa

>Os12t0247700-01 Similar to Jasmonate-induced protein.
MADPSKLQITPCGMLVQGNQINFTKLYLHHTPAGPEQNQSAVTSNDKKTGLGCIVVNNWS
VYDGIGSDAKLVAYAKGLHVFAGAWHNSFSLVFEDERLKGSTLQVMGLIVEEGDWAIVGG
TGQFAMATGVILKKMQEQKQYGNIIELTIHGFCPLLKGSQCPVTKIGPWGSSHEGTVQDI
TESPKRLESITLYHGWSVDSISFTYLDHAGEKHKAGPWGGPGGDPIMIEFGSSEFLKEVS
GTFGPYEGSTVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFFGRSGKYINAVG
VYVQPI*

5'UTR

chr12:8239432..8239503 (+ strand) : 72 bp

CDS

chr12:8239504..8239793 (+ strand) : 290 bp

chr12:8240098..8240287 (+ strand) : 190 bp

chr12:8240389..8240589 (+ strand) : 201 bp

chr12:8240698..8240937 (+ strand) : 240 bp

3'UTR

chr12:8240938..8241147 (+ strand) : 210 bp

FASTA

>Os12t0247700-01 class=Sequence position=chr12:8239432..8241147 (+ strand)
TACTCGCAGC GCATCACTCA CAGCTACATC CACAAGTACT AAACCAATCT CTGCCAGCAG TAGCTCTCAG CTATGGCTGA
TCCCAGCAAG CTGCAAATCA CACCCTGTGG CATGCTTGTT CAGGGCAACC AGATCAACTT CACCAAACTC TACCTGCACC
ACACGCCGGC TGGTCCAGAA CAAAACCAGT CGGCGGTCAC AAGCAATGAC AAAAAAACCG GGTTGGGTTG CATTGTCGTT
AACAACTGGT CAGTATATGA CGGAATCGGC AGCGACGCCA AGCTTGTTGC CTATGCAAAA GGCCTCCACG TTTTTGCGGG
TGCCTGGCAC AACTCCTTCA GCCTAGTGTT CGAGGATGAA AGGTACATAT AAATTAGTAG TAAAATTCAC TATTATattt
tctaataaaa ctatcgcaaa actaaatgtt ttgcaccatg ttaagtataa gattacaaca tttatgactt taacataaca
aattggtatg aacttaagcc ataaaatcta tagtcttgtg ataactctaa tattaaatct atatattttt tttacaagtc
atgtgttaaa actataattt tgcattgtga tgggacgcct taaatatgta gttttgcaat aatttgagca aagtaactgt
agttttctta tttacATGTG CTACAGGCTT AAGGGGTCCA CGCTTCAGGT GATGGGGCTA ATTGTCGAAG AAGGTGATTG
GGCTATTGTT GGGGGCACAG GACAGTTTGC TATGGCAACT GGTGTTATCT TGAAGAAAAT GCAAGAACAA AAACAATACG
GAAACATAAT AGAGCTCACT ATCCATGGGT TTTGTCCTCT CTTAAAAGGG TCACAGGTAA AAACAATATT AATCTATATT
TAGCTTTGTT GTATGTTATG AAGCACTTGA GATACTATAT CATAATCGAA TGTACGATGT ACATCCTATC TATGCAGTGC
CCTGTCACCA AGATTGGGCC ATGGGGTTCA TCTCATGAAG GGACAGTTCA AGACATCACT GAGTCTCCAA AGCGTCTCGA
AAGCATCACA TTATACCACG GCTGGTCTGT TGACTCAATC TCGTTTACTT ACCTTGACCA TGCCGGAGAG AAGCACAAGG
CAGGTCCATG GGGTGGTCCT GGCGGGGATC CCATAATGGT TAGTGAACTT CCACTGCAAA TTTTATTTAA CCAACAAGAA
AATAGTATAA TATATATATT CGGTTGTAAA ATACTTACAA CAGTTGTCCT TTTCCTTTGT ATGTAGATTG AATTTGGCAG
TTCAGAGTTT CTCAAGGAAG TTTCTGGAAC GTTTGGCCCA TATGAGGGCA GCACCGTTAT AACATCTATT AATTTTATCA
CCAATAAGCA AACATATGGC CCATTTGGAC GACAGGAGGG AACCCCTTTC AGTGTCCCAG CGCAGAATAA CTCCAGTATA
GTGGGTTTCT TTGGGCGCAG TGGGAAATAC ATAAATGCAG TTGGTGTCTA CGTGCAGCCG ATCTAACTTG TCAAAATAAG
TATTCCGTGT TTGAGTTTCA CGTGTGTTTT CTGCAGTAAA CAAATAAGAT GGGGGTCCTC CCTATCATTC CTGTTGTGAT
GAGTGATGCT TGGTCGCTGG AGTCCTTCTG AATTTACAGT CGTGTCCTAT CAGTTGTTTC TGTCTGTAGT GTGTTGCATG
CATCAATAAA GATCTTCATT GAAGGTTGGT TGTGTG