Os12t0268000-01

Locus

Os12g0268000

Description

Cytochrome P450 monooxygenase, Tryptamine 5-hydroxylase, Regulation of cell death and disease resistance

RAP-DB Gene Symbol Synonym(s)

SL, OsSL, CYP71P1, LLM1, CYP71A1, T5H

RAP-DB Gene Name Synonym(s)

Sekiguchi lesion, Cytochrome P450 71P1, large lesion mimic 1, tryptamine 5-hydroxylase

CGSNL Gene Symbol

SL

CGSNL Gene Name

SEKIGUCHI LESION

Oryzabase Gene Symbol Synonym(s)

OsSL, sl (spl1), sl*, sl, spl1, CYP71P1, Os CYP71P1, T5H, OsT5H, CYP71A1, OsCYP71A1, OsLLM1, LLM1, LLM1/OsSL

Oryzabase Gene Name Synonym(s)

Sekiguchi lesion, Cytochrome P450 71P1, tryptamine 5-hydroxylase, large lesion mimic 1

Transcript Evidence

AK071599

Protein Evidence

Q2QUC5

Literature

PMID: 30582769

PMID: 29735983

PMID: 20150424

Note

Manual Curation

January 24, 2019

Gene Ontology (GO)

Biological Process: oxidation-reduction process (GO:0055114)

Molecular Function: iron ion binding (GO:0005506)

Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (GO:0016705)

Molecular Function: heme binding (GO:0020037)

Functional domain (InterPro)

Cytochrome P450 superfamily (IPR036396)

Cytochrome P450 (IPR001128)

Cytochrome P450, E-class, group I (IPR002401)

Cytochrome P450, conserved site (IPR017972)

Full-length cDNA

J023107I12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0268000-01)

RiceXPro (AK071599)

Others

Oryzabase (2096)

KEGG (Os12t0268000-01 (EC 1.14.-.-))

Transcript

1904 bp

>Os12t0268000-01 Cytochrome P450 monooxygenase, Tryptamine 5-hydroxylase, Regulation of cell death and disease resistance
GTTCATACCAACACATCTCCATTGCTGCTTAAGTTTCTTGGACCAAACGTGCACCCCAAG
TGTTCGACGATATGGAGCTCACCATGGCGTCGACGATGTCGCTCGCGCTGCTCGTGCTCT
CCGCGGCGTACGTGTTGGTCGCGTTGAGGAGGAGCCGGTCGTCGTCGTCAAAGCCACGGC
GGCTGCCGCCGTCGCCGCCGGGGTGGCCGGTGATCGGGCACCTCCACCTCATGTCCGGCA
TGCCGCACCACGCGCTGGCCGAGCTGGCGCGCACCATGCGCGCGCCGCTGTTCCGGATGC
GGCTGGGGAGCGTGCCGGCGGTGGTGATCTCCAAGCCGGACCTCGCCCGCGCCGCGCTCA
CCACCAACGACGCCGCGCTGGCGTCGCGGCCGCACCTGCTCTCCGGCCAGTTCCTGTCGT
TCGGCTGCTCCGACGTGACGTTCGCGCCGGCGGGGCCGTACCACCGGATGGCGCGCCGCG
TGGTGGTGTCGGAGCTCCTGTCGGCGCGTCGCGTCGCCACGTACGGCGCCGTCAGGGTCA
AGGAGCTCCGCCGCCTGCTCGCGCACCTCACCAAGAACACCTCGCCGGCGAAGCCCGTCG
ACCTCAGCGAGTGCTTCCTCAACCTCGCCAACGACGTGCTCTGCCGCGTCGCGttcggcc
gccggttcccgcacggcgagggcgacaagctcggcgcggtgctcgccgaggcgcaggacc
tcttcgccgggttcaccatcggcgacttcttccccgagctcgagcccgtcgccagcaccg
tcaccggactccgccgccgcCTCAAGAAGTGCCTCGCCGACCTCCGCGAGGCCTGCGACG
TGATCGTGGACGAACACATCAGCGGCAACCGCCAGCGCATCCCCGGCGACCGCGACGAGG
ACTTCGTCGACGTCCTCCTCCGCGTCCAGAAATCCCCCGACCTCGAGGTCCCCCTAACCG
ACGACAATCTCAAGGCCCTCGTCCTGgacatgttcgtcgccggcacggacaccacgttcg
cgacgctggagtgggtgatgacggagctagtccgccacccacggatcctcaagaaggcgc
aggaggaggtccggcgagtcgtcggcgacagcggccgcgtcgaggagtcccacctcggcg
agctccactacatgcgcgccatcatcaaggagacgttccggctgcacccggcggtgccgt
tgctagtgccgcgcgagtccgtcgcgccgtgcacgctgggcggctacgacATCCCGGCGA
GGACGCGGGTGTTCATCAACACGTTCGCCATGGGGCGCGACCCGGAGATCTGGGACAACC
CGCTGGAGTACTCGCCGGAGAGGTTCGAGAGCGCCGGCGGCGGCGGCGAGATCGACCTCA
AGGACCCGGACTACAAGCTGCTGCCGTTCGGCGGCGGGCGGCGAGGGTGCCCCGGCTACA
CGTTCGCGCTCGCCACCGTGCAGGTGTCGCTCGCCAGCTTGCTCTACCACTTCGAGTGGG
CGCTGCCCGCCGGCGTGCGCGCCGAGGACGTCAACCTCGACGAGACGTTCGGCCTCGCCA
CGAGGAAGAAGGAGCCGCTCTTCGTCGCCGTCAGGAAGAGCGACGCGTACGAGTTTAAGG
GAGAGGAGCTTAGTGAGGTTTAAGTTAAATTAAGTAATGATTAGCGATAGATAGATTTTT
ATTATTTTTATTATGTTTTGGGATAATAATAAGGGTTAAAGTTTTGTGCTTGCTAAGTAA
CCTGGAGGCTGGAGCTGGTAATATTGTGACTAAGCAGAGAAGCAAGCCTGTGTGATTTCG
ATGTAAAAGTACAGGATATGGTGCCTAATGAATAAAAGAAGTCAATAAGTGGCGTATTTC
TCTTGTAACTTGTAAGCTATATCGAATTTTAAACTTTAGAGATT

CDS

1572 bp

>Os12t0268000-01 Cytochrome P450 monooxygenase, Tryptamine 5-hydroxylase, Regulation of cell death and disease resistance
ATGGAGCTCACCATGGCGTCGACGATGTCGCTCGCGCTGCTCGTGCTCTCCGCGGCGTAC
GTGTTGGTCGCGTTGAGGAGGAGCCGGTCGTCGTCGTCAAAGCCACGGCGGCTGCCGCCG
TCGCCGCCGGGGTGGCCGGTGATCGGGCACCTCCACCTCATGTCCGGCATGCCGCACCAC
GCGCTGGCCGAGCTGGCGCGCACCATGCGCGCGCCGCTGTTCCGGATGCGGCTGGGGAGC
GTGCCGGCGGTGGTGATCTCCAAGCCGGACCTCGCCCGCGCCGCGCTCACCACCAACGAC
GCCGCGCTGGCGTCGCGGCCGCACCTGCTCTCCGGCCAGTTCCTGTCGTTCGGCTGCTCC
GACGTGACGTTCGCGCCGGCGGGGCCGTACCACCGGATGGCGCGCCGCGTGGTGGTGTCG
GAGCTCCTGTCGGCGCGTCGCGTCGCCACGTACGGCGCCGTCAGGGTCAAGGAGCTCCGC
CGCCTGCTCGCGCACCTCACCAAGAACACCTCGCCGGCGAAGCCCGTCGACCTCAGCGAG
TGCTTCCTCAACCTCGCCAACGACGTGCTCTGCCGCGTCGCGttcggccgccggttcccg
cacggcgagggcgacaagctcggcgcggtgctcgccgaggcgcaggacctcttcgccggg
ttcaccatcggcgacttcttccccgagctcgagcccgtcgccagcaccgtcaccggactc
cgccgccgcCTCAAGAAGTGCCTCGCCGACCTCCGCGAGGCCTGCGACGTGATCGTGGAC
GAACACATCAGCGGCAACCGCCAGCGCATCCCCGGCGACCGCGACGAGGACTTCGTCGAC
GTCCTCCTCCGCGTCCAGAAATCCCCCGACCTCGAGGTCCCCCTAACCGACGACAATCTC
AAGGCCCTCGTCCTGgacatgttcgtcgccggcacggacaccacgttcgcgacgctggag
tgggtgatgacggagctagtccgccacccacggatcctcaagaaggcgcaggaggaggtc
cggcgagtcgtcggcgacagcggccgcgtcgaggagtcccacctcggcgagctccactac
atgcgcgccatcatcaaggagacgttccggctgcacccggcggtgccgttgctagtgccg
cgcgagtccgtcgcgccgtgcacgctgggcggctacgacATCCCGGCGAGGACGCGGGTG
TTCATCAACACGTTCGCCATGGGGCGCGACCCGGAGATCTGGGACAACCCGCTGGAGTAC
TCGCCGGAGAGGTTCGAGAGCGCCGGCGGCGGCGGCGAGATCGACCTCAAGGACCCGGAC
TACAAGCTGCTGCCGTTCGGCGGCGGGCGGCGAGGGTGCCCCGGCTACACGTTCGCGCTC
GCCACCGTGCAGGTGTCGCTCGCCAGCTTGCTCTACCACTTCGAGTGGGCGCTGCCCGCC
GGCGTGCGCGCCGAGGACGTCAACCTCGACGAGACGTTCGGCCTCGCCACGAGGAAGAAG
GAGCCGCTCTTCGTCGCCGTCAGGAAGAGCGACGCGTACGAGTTTAAGGGAGAGGAGCTT
AGTGAGGTTTAA

Protein

524 aa

>Os12t0268000-01 Cytochrome P450 monooxygenase, Tryptamine 5-hydroxylase, Regulation of cell death and disease resistance
MELTMASTMSLALLVLSAAYVLVALRRSRSSSSKPRRLPPSPPGWPVIGHLHLMSGMPHH
ALAELARTMRAPLFRMRLGSVPAVVISKPDLARAALTTNDAALASRPHLLSGQFLSFGCS
DVTFAPAGPYHRMARRVVVSELLSARRVATYGAVRVKELRRLLAHLTKNTSPAKPVDLSE
CFLNLANDVLCRVAFGRRFPHGEGDKLGAVLAEAQDLFAGFTIGDFFPELEPVASTVTGL
RRRLKKCLADLREACDVIVDEHISGNRQRIPGDRDEDFVDVLLRVQKSPDLEVPLTDDNL
KALVLDMFVAGTDTTFATLEWVMTELVRHPRILKKAQEEVRRVVGDSGRVEESHLGELHY
MRAIIKETFRLHPAVPLLVPRESVAPCTLGGYDIPARTRVFINTFAMGRDPEIWDNPLEY
SPERFESAGGGGEIDLKDPDYKLLPFGGGRRGCPGYTFALATVQVSLASLLYHFEWALPA
GVRAEDVNLDETFGLATRKKEPLFVAVRKSDAYEFKGEELSEV*

5'UTR

chr12:9581702..9581772 (- strand) : 71 bp

CDS

chr12:9580787..9581701 (- strand) : 915 bp

chr12:9580034..9580690 (- strand) : 657 bp

3'UTR

chr12:9579773..9580033 (- strand) : 261 bp

FASTA

>Os12t0268000-01 class=Sequence position=chr12:9579773..9581772 (- strand)
GTTCATACCA ACACATCTCC ATTGCTGCTT AAGTTTCTTG GACCAAACGT GCACCCCAAG TGTTCGACGA TATGGAGCTC
ACCATGGCGT CGACGATGTC GCTCGCGCTG CTCGTGCTCT CCGCGGCGTA CGTGTTGGTC GCGTTGAGGA GGAGCCGGTC
GTCGTCGTCA AAGCCACGGC GGCTGCCGCC GTCGCCGCCG GGGTGGCCGG TGATCGGGCA CCTCCACCTC ATGTCCGGCA
TGCCGCACCA CGCGCTGGCC GAGCTGGCGC GCACCATGCG CGCGCCGCTG TTCCGGATGC GGCTGGGGAG CGTGCCGGCG
GTGGTGATCT CCAAGCCGGA CCTCGCCCGC GCCGCGCTCA CCACCAACGA CGCCGCGCTG GCGTCGCGGC CGCACCTGCT
CTCCGGCCAG TTCCTGTCGT TCGGCTGCTC CGACGTGACG TTCGCGCCGG CGGGGCCGTA CCACCGGATG GCGCGCCGCG
TGGTGGTGTC GGAGCTCCTG TCGGCGCGTC GCGTCGCCAC GTACGGCGCC GTCAGGGTCA AGGAGCTCCG CCGCCTGCTC
GCGCACCTCA CCAAGAACAC CTCGCCGGCG AAGCCCGTCG ACCTCAGCGA GTGCTTCCTC AACCTCGCCA ACGACGTGCT
CTGCCGCGTC GCGttcggcc gccggttccc gcacggcgag ggcgacaagc tcggcgcggt gctcgccgag gcgcaggacc
tcttcgccgg gttcaccatc ggcgacttct tccccgagct cgagcccgtc gccagcaccg tcaccggact ccgccgccgc
CTCAAGAAGT GCCTCGCCGA CCTCCGCGAG GCCTGCGACG TGATCGTGGA CGAACACATC AGCGGCAACC GCCAGCGCAT
CCCCGGCGAC CGCGACGAGG ACTTCGTCGA CGTCCTCCTC CGCGTCCAGA AATCCCCCGA CCTCGAGGTC CCCCTAACCG
ACGACAATCT CAAGGCCCTC GTCCTGGTAC GCCATTAATA CCCACCATTA AAACTCTCGA ATTGACTCGC CGCCATTGTT
GCTCCTCCTC TGATCTTGAC ATGACGTGAC AACAACCACC Aggacatgtt cgtcgccggc acggacacca cgttcgcgac
gctggagtgg gtgatgacgg agctagtccg ccacccacgg atcctcaaga aggcgcagga ggaggtccgg cgagtcgtcg
gcgacagcgg ccgcgtcgag gagtcccacc tcggcgagct ccactacatg cgcgccatca tcaaggagac gttccggctg
cacccggcgg tgccgttgct agtgccgcgc gagtccgtcg cgccgtgcac gctgggcggc tacgacATCC CGGCGAGGAC
GCGGGTGTTC ATCAACACGT TCGCCATGGG GCGCGACCCG GAGATCTGGG ACAACCCGCT GGAGTACTCG CCGGAGAGGT
TCGAGAGCGC CGGCGGCGGC GGCGAGATCG ACCTCAAGGA CCCGGACTAC AAGCTGCTGC CGTTCGGCGG CGGGCGGCGA
GGGTGCCCCG GCTACACGTT CGCGCTCGCC ACCGTGCAGG TGTCGCTCGC CAGCTTGCTC TACCACTTCG AGTGGGCGCT
GCCCGCCGGC GTGCGCGCCG AGGACGTCAA CCTCGACGAG ACGTTCGGCC TCGCCACGAG GAAGAAGGAG CCGCTCTTCG
TCGCCGTCAG GAAGAGCGAC GCGTACGAGT TTAAGGGAGA GGAGCTTAGT GAGGTTTAAG TTAAATTAAG TAATGATTAG
CGATAGATAG ATTTTTATTA TTTTTATTAT GTTTTGGGAT AATAATAAGG GTTAAAGTTT TGTGCTTGCT AAGTAACCTG
GAGGCTGGAG CTGGTAATAT TGTGACTAAG CAGAGAAGCA AGCCTGTGTG ATTTCGATGT AAAAGTACAG GATATGGTGC
CTAATGAATA AAAGAAGTCA ATAAGTGGCG TATTTCTCTT GTAACTTGTA AGCTATATCG AATTTTAAAC TTTAGAGATT