Os12t0270200-01

Locus

Os12g0270200

Description

Pentatricopeptide repeat-DYW protein, RNA editing in mitochondria

RAP-DB Gene Symbol Synonym(s)

OGR1, ogr1

RAP-DB Gene Name Synonym(s)

OPAQUE AND GROWTH RETARDATION 1, opaque and growth retardation 1

CGSNL Gene Symbol

OGR1

CGSNL Gene Name

OPAQUE AND GROWTH RETARDATION 1

Oryzabase Gene Symbol Synonym(s)

ogr1

Oryzabase Gene Name Synonym(s)

opaque and growth retardation 1

Transcript Evidence

AK242649 (Genbank)

Protein Evidence

B8YEK4 (UniProt)

Literature

PMID: 19453459

Note

Manual Curation

September 1, 2009

Functional domain (InterPro)

Pentatricopeptide repeat (IPR002885)

Full-length cDNA

J090025M16 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0270200-01)

Others

Oryzabase (8774)

KEGG (Os12t0270200-01)

Transcript

3241 bp

>Os12t0270200-01 Pentatricopeptide repeat-DYW protein, RNA editing in mitochondria
GGTCGCCGCGCCGATTAGGGGTATCCCCCCCCCCCCCCCCCCCCCCCGCGGGCGTCCATG
TCGGTGTCGGCGGCGGCGCGGCATCTGGAATCCCTCCTCCCGCGCCTGGCCTCCCTCCGC
CACTACCTGCAGTTCCACGCGCGCCTCCTCACCTCGGGCCACCTCGGCGCCCACCCGGGC
CTCCGCGCCCGCTTCCTCGACCGCCTCGCGCTCTCGCCGCACCCCGCCGCGCTCCCCCAC
GCGCTGCTCCTCCTCCGCTCCCTCCCTACCCCGGCCACCAACGACCTCAACGCCGCGCTC
AGGGGgctcgccgcctcgccgcacccggcccgctcgctcctcctcctcgcgggccgcctc
ctccccgccctgctccctcgccccgacgcgctctcgctctccttcgcgctcaaggcgtcc
gcccgctgctccgacgcgcacaccacggtgcagctccacgcgctcgtcctccgcctcggc
gtcgccgccgacgtccGGCTGCTAACCACGCTGCTTGACTCGTACGCCAAGTGTGGAGAT
CTCGCGTCCGCGCGGAAGGTGTTTGATGAAATGACCGTGCGGGACGTGGCCACATGGAAC
TCGCTGCTGGCGGGGCTAGCGCAAGGCACGGAGCCTAACCTTGCTCTCGCGCTGTTCCAC
AGGCTGGCTAACAGCTTCCAGGAGTTGCCGTCGAGGGAGGAACCCAATGAGGTGACTATT
GTTGCGGCGCTTTCCGCGTGTGCGCAGATTGGCTTGTTAAAAGATGGGATGTATGTGCAC
GAGTTTGCTAAAAGATTTGGACTGGATCGCAATGTTCGGGTCTGCAATTCACTAATTGAC
ATGTACTCCAAGTGTGGCTCGCTGTCAAGGGCCCTGGATGTGTTCCATTCCATCAAGCCG
GAAGACCAGACGCTTGTGTCCTACAATGCTGCAATTCAGGCACATTCCATGCATGGGCAT
GGGGGTGATGCACTGAGATTGTTTGATGAAATGCCCACACGCATTGAGCCAGATGGAGTG
ACTTACCTTGCTGTGTTGTGCGGGTGCAACCATTCTGGCCTTGTGGATGATGGGCTCAGG
GTATTCAACTCGATGCGAGTTGCTCCAAATATGAAGCACTATGGAACAATTGtggacctt
cttggccgtgcaggccgtctcactgaggcatatgacaccgtcatttctatgccatttcca
gctgatattgtcctttggcagacattgttgggtgcagccaagatgcatggggttgttgag
cttgcggagttggctgccaataaacttgctgagcttggttctaatgtcgatggtgactat
gtgctcctatcgaatgtttatgcatccaaggctcggtggatggatgttggtcgagtacgt
gataccatgcgaagcaacgatgtgcgaaaagttcctggcttcagctacacagaaatagat
ggagtaatgcataagtttattaatggtgacaaagagcacccgaggtggcaagagatatac
agagcactggaggacattgtatcaagaattagtgagctaggatatgagccagagacaagc
aatgtactgcatgacattggggaggaggaaaaacagtatgcattgtgttatcatagtgag
aagctggccattgcatttgggttgattgcaacaccacctggggagactcttcgggtgatc
aaaaatctccgaatatgtggggactgtcatgtggtggcaaagctcatctcTAAAGCTTAT
GGTCGTGTTATTGTCATTCGGGACAGGGCGAGATTCCATCGATTTGAAGATGGGCAGTGT
TCCTGCAGGGATTACTGGTAAATAGTGGCATGCTGGATCATTTAAAGGATAAATTTGGCA
TGAGCTCGTGGAGATGAGGTCAAAAAGGATGATATAACATGTCTCTGATCCAGCATATCG
ATTTGTATGGATACTGGAACATATTCTTGAACCATGCATATCACTTCTGACACTTCACAC
AATGGGTCAAACATCAAAAGGTTGTTCGAGATATAATCCAGGGCTCCAGGCTTGCTGTTG
CAGATACATTCAATTTAGTCCCCATTGAAATTAATCTTGTAAGTTAGGGTGTGGGTGGTT
TGAAAATCCTCCACTTAGCCTTCACAGAGAATGATCTTGAGAATGAAATACCAAATACAG
TATACACGGTTTGAGGTTTCCGGATGGTTTCTGCTGCCACTGGACCTCACAACCCTACAA
AGGTTTATAATCACCAAGAGTCCAGGACACAACTGGATAGTCACAATGCCGTAGGTTACA
ACTAGCATTCAGCTGGTAATGGTATGGTACTAATGAAAAACTGACATCAGGATAGGAGCA
TGCTATTTTTCCTTTCAGGGAGACAACATAATTTTTCATATCTACGGAGCGAAGTTTTCC
TTCAAGTCTTTGGTTCTTTGTCCCGATTCCTTAATATTTGGAAGGCCACGACGCAGGTGA
AACTAGCAAAAAAAAAAGATGGACGAGCTCCGGGCCTTGTTTCTTGCCAGACTTTGTCTT
CTACACGCGGCAAGAGATACAGGATGTGGACGGAGAAAAAGATGCTGGACGCGCAGACAG
GCATGATATCCTACAAAATTGCTGCTCATGCTGCTGATTTGGCAAAGTGCCATCCGTATG
CACAAGCATGGGACGATACACTAAGCAAGGCAAGATTTGAGTTTAGATGGTTGGATCAAT
TTGCTCTGTATCTGGATCCTGTGACCACTATGTCTTTCCATGATGAAACATTACCATCGG
AGGGTGCCAAAGTAGCACATTTCTGCTCAATGTGTGGCCCAAAGTCTTGTTCGATGAAAA
TCACAGAGGATATTAGAAAATATGCTGATGAACATGGTTACAGGATAGTGGAGGAAGCGG
TAATACCAGGAATGAATGCTATGAGTGCTGAGTTTTTGGCTGCAAGGAAAACGATCAGTG
GGGAGCAACACGGTGAAGCTGGAGGGGAGATCTATGTTCCAGAAAGCTATACAGCTCGCA
AATAAGATCATCTTGGCGTCCATCTACTCCGGGTGATAAAGATTTACTGACTGGAGCGTT
TATCAGCAGCACTCACCATCCTATGTTAGGGAGGTGGTAAGCAGTTTATGTGCTTTGATA
AAGCTGGTGTTGCTTAGCTCAgtttctcctaacccatccacttttcgagcttgtatgcta
ctccttttagtattgtcaaaatcttgtttcgacaTGAAGTGAAAAGTTGTGTGAAAAGAT
C

CDS

1764 bp

>Os12t0270200-01 Pentatricopeptide repeat-DYW protein, RNA editing in mitochondria
ATGTCGGTGTCGGCGGCGGCGCGGCATCTGGAATCCCTCCTCCCGCGCCTGGCCTCCCTC
CGCCACTACCTGCAGTTCCACGCGCGCCTCCTCACCTCGGGCCACCTCGGCGCCCACCCG
GGCCTCCGCGCCCGCTTCCTCGACCGCCTCGCGCTCTCGCCGCACCCCGCCGCGCTCCCC
CACGCGCTGCTCCTCCTCCGCTCCCTCCCTACCCCGGCCACCAACGACCTCAACGCCGCG
CTCAGGGGgctcgccgcctcgccgcacccggcccgctcgctcctcctcctcgcgggccgc
ctcctccccgccctgctccctcgccccgacgcgctctcgctctccttcgcgctcaaggcg
tccgcccgctgctccgacgcgcacaccacggtgcagctccacgcgctcgtcctccgcctc
ggcgtcgccgccgacgtccGGCTGCTAACCACGCTGCTTGACTCGTACGCCAAGTGTGGA
GATCTCGCGTCCGCGCGGAAGGTGTTTGATGAAATGACCGTGCGGGACGTGGCCACATGG
AACTCGCTGCTGGCGGGGCTAGCGCAAGGCACGGAGCCTAACCTTGCTCTCGCGCTGTTC
CACAGGCTGGCTAACAGCTTCCAGGAGTTGCCGTCGAGGGAGGAACCCAATGAGGTGACT
ATTGTTGCGGCGCTTTCCGCGTGTGCGCAGATTGGCTTGTTAAAAGATGGGATGTATGTG
CACGAGTTTGCTAAAAGATTTGGACTGGATCGCAATGTTCGGGTCTGCAATTCACTAATT
GACATGTACTCCAAGTGTGGCTCGCTGTCAAGGGCCCTGGATGTGTTCCATTCCATCAAG
CCGGAAGACCAGACGCTTGTGTCCTACAATGCTGCAATTCAGGCACATTCCATGCATGGG
CATGGGGGTGATGCACTGAGATTGTTTGATGAAATGCCCACACGCATTGAGCCAGATGGA
GTGACTTACCTTGCTGTGTTGTGCGGGTGCAACCATTCTGGCCTTGTGGATGATGGGCTC
AGGGTATTCAACTCGATGCGAGTTGCTCCAAATATGAAGCACTATGGAACAATTGtggac
cttcttggccgtgcaggccgtctcactgaggcatatgacaccgtcatttctatgccattt
ccagctgatattgtcctttggcagacattgttgggtgcagccaagatgcatggggttgtt
gagcttgcggagttggctgccaataaacttgctgagcttggttctaatgtcgatggtgac
tatgtgctcctatcgaatgtttatgcatccaaggctcggtggatggatgttggtcgagta
cgtgataccatgcgaagcaacgatgtgcgaaaagttcctggcttcagctacacagaaata
gatggagtaatgcataagtttattaatggtgacaaagagcacccgaggtggcaagagata
tacagagcactggaggacattgtatcaagaattagtgagctaggatatgagccagagaca
agcaatgtactgcatgacattggggaggaggaaaaacagtatgcattgtgttatcatagt
gagaagctggccattgcatttgggttgattgcaacaccacctggggagactcttcgggtg
atcaaaaatctccgaatatgtggggactgtcatgtggtggcaaagctcatctcTAAAGCT
TATGGTCGTGTTATTGTCATTCGGGACAGGGCGAGATTCCATCGATTTGAAGATGGGCAG
TGTTCCTGCAGGGATTACTGGTAA

Protein

588 aa

>Os12t0270200-01 Pentatricopeptide repeat-DYW protein, RNA editing in mitochondria
MSVSAAARHLESLLPRLASLRHYLQFHARLLTSGHLGAHPGLRARFLDRLALSPHPAALP
HALLLLRSLPTPATNDLNAALRGLAASPHPARSLLLLAGRLLPALLPRPDALSLSFALKA
SARCSDAHTTVQLHALVLRLGVAADVRLLTTLLDSYAKCGDLASARKVFDEMTVRDVATW
NSLLAGLAQGTEPNLALALFHRLANSFQELPSREEPNEVTIVAALSACAQIGLLKDGMYV
HEFAKRFGLDRNVRVCNSLIDMYSKCGSLSRALDVFHSIKPEDQTLVSYNAAIQAHSMHG
HGGDALRLFDEMPTRIEPDGVTYLAVLCGCNHSGLVDDGLRVFNSMRVAPNMKHYGTIVD
LLGRAGRLTEAYDTVISMPFPADIVLWQTLLGAAKMHGVVELAELAANKLAELGSNVDGD
YVLLSNVYASKARWMDVGRVRDTMRSNDVRKVPGFSYTEIDGVMHKFINGDKEHPRWQEI
YRALEDIVSRISELGYEPETSNVLHDIGEEEKQYALCYHSEKLAIAFGLIATPPGETLRV
IKNLRICGDCHVVAKLISKAYGRVIVIRDRARFHRFEDGQCSCRDYW*

5'UTR

chr12:9777776..9777832 (+ strand) : 57 bp

CDS

chr12:9777833..9779596 (+ strand) : 1764 bp

3'UTR

chr12:9779597..9780213 (+ strand) : 617 bp

chr12:9780608..9780745 (+ strand) : 138 bp

chr12:9781140..9781569 (+ strand) : 430 bp

chr12:9782224..9782458 (+ strand) : 235 bp

FASTA

>Os12t0270200-01 class=Sequence position=chr12:9777776..9782458 (+ strand)
GGTCGCCGCG CCGATTAGGG GTATCCCCCC CCCCCCCCCC CCCCCCCGCG GGCGTCCATG TCGGTGTCGG CGGCGGCGCG
GCATCTGGAA TCCCTCCTCC CGCGCCTGGC CTCCCTCCGC CACTACCTGC AGTTCCACGC GCGCCTCCTC ACCTCGGGCC
ACCTCGGCGC CCACCCGGGC CTCCGCGCCC GCTTCCTCGA CCGCCTCGCG CTCTCGCCGC ACCCCGCCGC GCTCCCCCAC
GCGCTGCTCC TCCTCCGCTC CCTCCCTACC CCGGCCACCA ACGACCTCAA CGCCGCGCTC AGGGGgctcg ccgcctcgcc
gcacccggcc cgctcgctcc tcctcctcgc gggccgcctc ctccccgccc tgctccctcg ccccgacgcg ctctcgctct
ccttcgcgct caaggcgtcc gcccgctgct ccgacgcgca caccacggtg cagctccacg cgctcgtcct ccgcctcggc
gtcgccgccg acgtccGGCT GCTAACCACG CTGCTTGACT CGTACGCCAA GTGTGGAGAT CTCGCGTCCG CGCGGAAGGT
GTTTGATGAA ATGACCGTGC GGGACGTGGC CACATGGAAC TCGCTGCTGG CGGGGCTAGC GCAAGGCACG GAGCCTAACC
TTGCTCTCGC GCTGTTCCAC AGGCTGGCTA ACAGCTTCCA GGAGTTGCCG TCGAGGGAGG AACCCAATGA GGTGACTATT
GTTGCGGCGC TTTCCGCGTG TGCGCAGATT GGCTTGTTAA AAGATGGGAT GTATGTGCAC GAGTTTGCTA AAAGATTTGG
ACTGGATCGC AATGTTCGGG TCTGCAATTC ACTAATTGAC ATGTACTCCA AGTGTGGCTC GCTGTCAAGG GCCCTGGATG
TGTTCCATTC CATCAAGCCG GAAGACCAGA CGCTTGTGTC CTACAATGCT GCAATTCAGG CACATTCCAT GCATGGGCAT
GGGGGTGATG CACTGAGATT GTTTGATGAA ATGCCCACAC GCATTGAGCC AGATGGAGTG ACTTACCTTG CTGTGTTGTG
CGGGTGCAAC CATTCTGGCC TTGTGGATGA TGGGCTCAGG GTATTCAACT CGATGCGAGT TGCTCCAAAT ATGAAGCACT
ATGGAACAAT TGtggacctt cttggccgtg caggccgtct cactgaggca tatgacaccg tcatttctat gccatttcca
gctgatattg tcctttggca gacattgttg ggtgcagcca agatgcatgg ggttgttgag cttgcggagt tggctgccaa
taaacttgct gagcttggtt ctaatgtcga tggtgactat gtgctcctat cgaatgttta tgcatccaag gctcggtgga
tggatgttgg tcgagtacgt gataccatgc gaagcaacga tgtgcgaaaa gttcctggct tcagctacac agaaatagat
ggagtaatgc ataagtttat taatggtgac aaagagcacc cgaggtggca agagatatac agagcactgg aggacattgt
atcaagaatt agtgagctag gatatgagcc agagacaagc aatgtactgc atgacattgg ggaggaggaa aaacagtatg
cattgtgtta tcatagtgag aagctggcca ttgcatttgg gttgattgca acaccacctg gggagactct tcgggtgatc
aaaaatctcc gaatatgtgg ggactgtcat gtggtggcaa agctcatctc TAAAGCTTAT GGTCGTGTTA TTGTCATTCG
GGACAGGGCG AGATTCCATC GATTTGAAGA TGGGCAGTGT TCCTGCAGGG ATTACTGGTA AATAGTGGCA TGCTGGATCA
TTTAAAGGAT AAATTTGGCA TGAGCTCGTG GAGATGAGGT CAAAAAGGAT GATATAACAT GTCTCTGATC CAGCATATCG
ATTTGTATGG ATACTGGAAC ATATTCTTGA ACCATGCATA TCACTTCTGA CACTTCACAC AATGGGTCAA ACATCAAAAG
GTTGTTCGAG ATATAATCCA GGGCTCCAGG CTTGCTGTTG CAGATACATT CAATTTAGTC CCCATTGAAA TTAATCTTGT
AAGTTAGGGT GTGGGTGGTT TGAAAATCCT CCACTTAGCC TTCACAGAGA ATGATCTTGA GAATGAAATA CCAAATACAG
TATACACGGT TTGAGGTTTC CGGATGGTTT CTGCTGCCAC TGGACCTCAC AACCCTACAA AGGTTTATAA TCACCAAGAG
TCCAGGACAC AACTGGATAG TCACAATGCC GTAGGTTACA ACTAGCATTC AGCTGGTAAT GGTATGGTAC TAATGAAAAA
CTGACATCAG GATAGGAGCA TGCTATTTTT CCTTTCAGGG AGACAACATA ATTTTTCATA TCTACGGAGC GAAGTTTTCC
TTCAAGTCTT TGGTTCTTTG TCCCGATTCC TTAATATTGT AAGTTACAGT CATGGTTCAG CTGTTCCATT CCATTAATAG
CTGATGATTT CATTGTCGAT TTTGATGATG CATAATAAGA TGCGCCTTTA TATGGTTTAA TCTAGAATCC CTTGCAATGA
TGATACTATA GTGATGAAGT AAACTTATCC TGGATTATAA TAAATACAAA TTTTTGCCTT ATCTTTGTGC TATGATCATT
GATGCATTTG GCAGTTTTGG TCAGTACCAA CGTGGTCGTA AAATAATCAT TGCATGATAT TTTCCACACA TAATTTTGTT
TGCAGTGGAG TTTGGGCTAT CTGGTTCTGT GTGAAATTAT TGGGTTTTCA AAAACATTTC ATTGAGCGAT GTCATGTAGC
TTCCTCACAA GGATTTGTCA CTTTTGCAAC AGTGGAAGGC CACGACGCAG GTGAAACTAG CAAAAAAAAA AGATGGACGA
GCTCCGGGCC TTGTTTCTTG CCAGACTTTG TCTTCTACAC GCGGCAAGAG ATACAGGATG TGGACGGAGA AAAAGATGCT
GGACGCGCAG GTGAGGTCTG CTCTTGGTTT TTTAAGCAAC TGCATCTATG TTAACTTTGA tggtcaaagt tagtcatgtc
tcacttagaa caaatctaaa atgacaataa gtttgaaaca gagggaATGT TTTACATAAT CTTACAATTA ATTATTACAT
GGTCTAAAGG AAAAAACACA TTGAATTATT GAAAACCAAG TGTAAGCTTA ACCGGTGTTG TAAATAATGA TCCCTTAGAT
ACAACTTTCG TTTATATTGA AGCCGATTTA TGCACGGGAG AATGTTTGAT GCTGCCAACA TTGGGGCCAT TGGTGCTGCC
AACATTGGGG CTCTTGGCAC TGCACTTCTC TGTTATGTAA CACCAAAGGA GCACCTTGGA TTGCCTAACC GTGATGATGT
TTAGACAGGC ATGATATCCT ACAAAATTGC TGCTCATGCT GCTGATTTGG CAAAGTGCCA TCCGTATGCA CAAGCATGGG
ACGATACACT AAGCAAGGCA AGATTTGAGT TTAGATGGTT GGATCAATTT GCTCTGTATC TGGATCCTGT GACCACTATG
TCTTTCCATG ATGAAACATT ACCATCGGAG GGTGCCAAAG TAGCACATTT CTGCTCAATG TGTGGCCCAA AGTCTTGTTC
GATGAAAATC ACAGAGGATA TTAGAAAATA TGCTGATGAA CATGGTTACA GGATAGTGGA GGAAGCGGTA ATACCAGGAA
TGAATGCTAT GAGTGCTGAG TTTTTGGCTG CAAGGAAAAC GATCAGTGGG GAGCAACACG GTGAAGCTGG AGGGGAGATC
TATGTTCCAG AAAGCTATAC AGCTCGCAAA TAAGGTTGGT CTTTTTCTTA TGATGTATAG TTCAACTTGT GGGAGATGTT
TGGACTCTTT TGTTCTGAAT GTGTAGGGTT GTTTACTCGG TATGAAGTAA TTAGTCATCT GGGAGTAAAA TGGTCTAGTG
CCATATTTCA ATCAGTTTTA CATAAATAAG CCATTAGTGT GTGCTTACCG TCTTGAAACA GCGTCAGCTT GTTGTTGGCC
CAATAACTTC ATACATGCTA GTACTAGTTA TTTAGCATTA GTGCAACTTG TTACAAATAT TTCTGAATTA TCTGGACTAT
AAATAAATAC TACTCGAGTA CTATCTACCA TTTGGTAAAC ATTCTGCTAA TCCTTTTATG TCAGAATTGT TTCATAAATC
TATGAGAACT GTTGTAATTT TGACTCCACA CATTCTCTTC AGTGATATTT CTTAAGGGAA AATTACTCTC ACAGCAATCC
TTTGAAATGG GTTTGCTTGT ACATTTGAAA TTTGACACTA ACTGTAATAG CAGTGGATAG CTGCTCTGTC TTTATCAACT
TCTACTTGTA ATTTCAGGGA CCTTAATAAA CCTTTAGTGG CTTGGACTTA TTGTGCATTA CTGCAAAGGC ACTAACTTTT
ATATCACTAT AACATGTTCT CGGAACTCAG AATACAATCT CTGTGCAGAT CATCTTGGCG TCCATCTACT CCGGGTGATA
AAGATTTACT GACTGGAGCG TTTATCAGCA GCACTCACCA TCCTATGTTA GGGAGGTGGT AAGCAGTTTA TGTGCTTTGA
TAAAGCTGGT GTTGCTTAGC TCAgtttctc ctaacccatc cacttttcga gcttgtatgc tactcctttt agtattgtca
aaatcttgtt tcgacaTGAA GTGAAAAGTT GTGTGAAAAG ATC

Locus: Os12g0270200

Loading...

Locus: Os12g0270200

Loading...