Os12t0281300-01

Locus

Os12g0281300

Description

Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)

RAP-DB Gene Symbol Synonym(s)

Pi-ta

RAP-DB Gene Name Synonym(s)

Pyricularia oryzae resistance-ta

CGSNL Gene Symbol

PITA

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE TA

Oryzabase Gene Symbol Synonym(s)

Pita, Pita (sl, Pi4a, Pi-ta), Pita2, Pi4a, Pita, Pi-ta, Pita-2, Pi-ta2, Pi-4(t), Pi-4, Pi4, Pi-4a(t), OsTRXh6, TRXh6, OsTrx30

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance-ta, Magnaporthe grisea resistance-ta, Blast resistance ta, Thioredoxin H-type 6, H-type Thioredoxin 6, Thioredoxin 30

Transcript Evidence

AK066558

Protein Evidence

Q2QTV7

Literature

PMID: 11090207

DOI: 10.1016/j.plantsci.2009.07.012

Note

Manual Curation

July 26, 2018

Gene Ontology (GO)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Leucine-rich repeat domain superfamily (IPR032675)

NB-ARC (IPR002182)

Full-length cDNA

J013072N20 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0281300-01)

RiceXPro (AK066558)

Others

Oryzabase (947)

KEGG (Os12t0281300-01)

Transcript

4036 bp

>Os12t0281300-01 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
ACTAGATAGGATTAAGTTTCAAGAGTTAATTTCTTGTACTCTTGGGCGATCCATGCTGTC
AAATCAGCAACTAACGAGGCATAATCTCGATCACTAGCTCTGATCTGATCTTCAGCTAGC
GCCGGCGAGCTGCAGAGGTCTCCATCCATGGCGCCGGCGGTCAGTGCATCGCAGGGTGTC
ATCATGCGGTCCCTGACGAGCAAGCTCGACTCGCTGCTGCTGCAGCCGCCGGAGCCGCCG
CCGCCTGCGCAACCGTCGTCGCTGCGGAAGGGGGAGAGGAAGAAGATCCTCCTCCTCAGA
GGCGATCTCCGACACCTGCTAGATGACTACTACCTCCTCGTGGAGCCGCCGTCAGACACC
GCGCCACCGCCAGACTCGACGGCGGCGTGCTGGGCTAAGGAGGTTCGCGAGCTCTCCTAC
GACGTCGACGACTTCCTCGACGAGCTAACGACCCAGCTCCTCCACCACCGCGGCGGCGGC
GATGGCAGTAGCACTGCTGGTGCCAAGAAGATGATCAGCAGCATGATCGCCCGGCTTCGA
GGGGAGCTTAACCGGCGGCGGTGGATCGCCGACGAGGTCACCCTGTTCAGCGCCCGCGTG
AAGGAGGCCATTCGCCGCCAGGAGAGCTACCATCTTGGCAGGCGCACCTCGAGCTCGAGG
CCGAGAGAAGAAGTCGACGACGACGATCGCGAGGACTCCGCCGGCAACGAACGCCGCCGG
TTTCTGTCGCTGACGTTCGGGATGGACGACGCTGCTGTGCACGGCCAGCTCGTTGGTAGG
GATATTTCGATGCAAAAGCTCGTCCGGTGGCTGGCCGACGGCGAGCCGAAGctcaaggtg
gcttccattgttggatccggaggtgttggcaagacgacgctggcCACAGAATTCTATCGT
CTGCATGGCCGGCGGTTGGATGCGCCGTTCGACTGCCGGGCTTTCGTGCGGACGCCCCGG
AAGCCTGACATGACGAAGATCCTCACCGACATGCTGTCACAGCTGCGGCCACAACATCAG
CATCAGTCTTCGGATGTTTGGGAGGTTGATCGACTCCTTGAAACTATCCGGACGCATTTG
CAAGATAAAAGgtacttcatcataattgaagatttatgggcttcatcaatgtgggatatt
gttagccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaatt
gaacctgtagctttggcatgctgtggatataactcagagcacattattaagattgatcca
ctgggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaa
tttcctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgcca
ctagcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaa
tggaatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcag
gggatgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgt
ctgttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgagg
caatggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgca
gggaactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgc
aaaaatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaag
tcaatagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgct
gacaaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagca
ggtttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgcct
tccattgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagag
aaaacaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagata
acaggtaatATCACAGTTAAACTTCCAGAGAAGATCCAAGGACTACAACACTTGCAGACA
CTGGAAGCAGATGCAAGAGCAACTGCTGTCCTATTGGATATTGTTCATACACAGTGTTTG
TTGCACCTTCGTCTTGTACTACTTGATCTGCTCCCTCACTGTCACAGGTACATCTTCACC
AGCATCCCCAAATGGACTGGAAAGCTCAACAATCTCCGCATTTTAAACATTGCAGTCATG
CAAATTTCCCAGGATGACCTTGACACTCTCAAAGGACTGGGATCTCTCACTGCTCTTTCG
CTGCTTGTTCGAACAGCGCCTGCGCAAAGAATCGTCGCTGCGAATGAGGGGTTCGGGTCT
CTCAAGTACTTCATGTTTGTCTGTACAGCACCATGCATGACTTTTGTGGAAGGAGCAATG
CCGAGTGTGCAAAGATTAAATCTAAGGTTCAATGCCAACGAGTTCAAGCAGTATGACTCT
AAGGAGACAGGGTTGGAACACTTGGTCGCCCTTGCAGAGATCTCTGCAAGAATTGGGGGC
ACTGATGATGATGAATCAAACAAAACTGAAGTGGAGTCTGCCTTGAGGACTGCAATTCGC
AAGCATCCGACGCCGAGCACTCTTATGGTTGATATACAATGGGTGGATTGGATCTTTGGT
GCTGAAGGGAGAGACTTGGATGAAGATTTGGCACAACAAGATGATCACGGGTATGGATTT
TTCATTCTATTCCCAGGTTACAACTTACAAGGATTATTGAGCTTCTTTCTTTCTCTGCCG
TGGCTTCTATCTTTACCTTCTATGCATCTTCAACCTGACTTGATGATTGTTTGAAACCAA
TTTTAATGGAAGTTAAATGTTATTGTTGTGACCCTGAATCAGGTTTTGTATGCTACCGGA
ATCCTCTTCACGTCTTCAGAGTAGAGGTAATTTTGTTTCTTGTCATTTTACAGTTACAGT
TCATCTACTTAAGGAATTAATGGGAGGTCCTATATTTTCTCGGGTACCTAGAAGGTGTGG
TTCCTAGTCTTACCTCCTTAAGAACCGTAGAATGTTGGCCCTAACACTTGGATCAAAGAA
CGAAAGGTGTATGCACTATAGTATCCTTTATATATTGCACAAGTCAAGACATTTGTTAAA
ACACACCCAGTGCTAGTAATTTGTTTACTGAGATATGAATTATCGCCAAATACCCATACT
GAGCCTATTAGTAAAATATTTACGAGGTGTTTGAGGACAGCATAACTTTCAGTAAAGAAT
TTACTACGTGAGGTGTGTGTTTTAGGTATTGCGCATCTTGGGTGCATTTTAGCGCAAACG
TGTATAATATATATCCCATGGTACTAACTCATGTCTTAACCATAATTGCACACCAACACA
AAACATACACTACTACAGAGATAAGTATCGAAGAAGACATGCCCACCGGTGCGGAAGGGA
CGGTGATTGTGCCCCACACAATGGAGCAGTTCGCCCTCCACATGAGCCAAGCCAAGCAAT
CCCACAAGCTCGTAGTCATCCAGTTCACTACTTCCCGGTGCCCTGCTTCACGCTACATCG
CGCCAGCTTTCACCGAGTATGCGAAGGAGTTCGCTGGTGCGGTTTTCATTAAGGTCAATG
TCGACAGCGATGAGCTGGAGAGTGTTACGGACTGGTATGACATCGAAGGGATAGTGCCAA
CATTTTTCTTCGTCAAGGATGGGGAGAAGATTGACAAGATTCCTGGTGCTAACAAGGAGT
TGCTCCGAGCCAAAATTCGAAGGCACACAGCTTCTCCTTACTTCCTCCGTTGATAATGAC
TTCTTTTATCGTCTTTGTCTAGTATATATATGGCACTTATATAGTTAACTAGGAAGGGCA
CCTTGTTTAATGTAGCTTTCATTTTTATTATGAATGTTAAGGATGATATTATATTGTTGA
AGTATTTTTTTACTCC

CDS

2787 bp

>Os12t0281300-01 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
ATGGCGCCGGCGGTCAGTGCATCGCAGGGTGTCATCATGCGGTCCCTGACGAGCAAGCTC
GACTCGCTGCTGCTGCAGCCGCCGGAGCCGCCGCCGCCTGCGCAACCGTCGTCGCTGCGG
AAGGGGGAGAGGAAGAAGATCCTCCTCCTCAGAGGCGATCTCCGACACCTGCTAGATGAC
TACTACCTCCTCGTGGAGCCGCCGTCAGACACCGCGCCACCGCCAGACTCGACGGCGGCG
TGCTGGGCTAAGGAGGTTCGCGAGCTCTCCTACGACGTCGACGACTTCCTCGACGAGCTA
ACGACCCAGCTCCTCCACCACCGCGGCGGCGGCGATGGCAGTAGCACTGCTGGTGCCAAG
AAGATGATCAGCAGCATGATCGCCCGGCTTCGAGGGGAGCTTAACCGGCGGCGGTGGATC
GCCGACGAGGTCACCCTGTTCAGCGCCCGCGTGAAGGAGGCCATTCGCCGCCAGGAGAGC
TACCATCTTGGCAGGCGCACCTCGAGCTCGAGGCCGAGAGAAGAAGTCGACGACGACGAT
CGCGAGGACTCCGCCGGCAACGAACGCCGCCGGTTTCTGTCGCTGACGTTCGGGATGGAC
GACGCTGCTGTGCACGGCCAGCTCGTTGGTAGGGATATTTCGATGCAAAAGCTCGTCCGG
TGGCTGGCCGACGGCGAGCCGAAGctcaaggtggcttccattgttggatccggaggtgtt
ggcaagacgacgctggcCACAGAATTCTATCGTCTGCATGGCCGGCGGTTGGATGCGCCG
TTCGACTGCCGGGCTTTCGTGCGGACGCCCCGGAAGCCTGACATGACGAAGATCCTCACC
GACATGCTGTCACAGCTGCGGCCACAACATCAGCATCAGTCTTCGGATGTTTGGGAGGTT
GATCGACTCCTTGAAACTATCCGGACGCATTTGCAAGATAAAAGgtacttcatcataatt
gaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataat
agttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtgga
tataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattg
tttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttct
catgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacat
tttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgact
acttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatt
tacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagag
gactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaat
tccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggt
aggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtg
caccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattaca
ttggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcac
ttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcg
atggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcga
gttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatt
tctgaactgttacaactgagatatctgaagataacaggtaatATCACAGTTAAACTTCCA
GAGAAGATCCAAGGACTACAACACTTGCAGACACTGGAAGCAGATGCAAGAGCAACTGCT
GTCCTATTGGATATTGTTCATACACAGTGTTTGTTGCACCTTCGTCTTGTACTACTTGAT
CTGCTCCCTCACTGTCACAGGTACATCTTCACCAGCATCCCCAAATGGACTGGAAAGCTC
AACAATCTCCGCATTTTAAACATTGCAGTCATGCAAATTTCCCAGGATGACCTTGACACT
CTCAAAGGACTGGGATCTCTCACTGCTCTTTCGCTGCTTGTTCGAACAGCGCCTGCGCAA
AGAATCGTCGCTGCGAATGAGGGGTTCGGGTCTCTCAAGTACTTCATGTTTGTCTGTACA
GCACCATGCATGACTTTTGTGGAAGGAGCAATGCCGAGTGTGCAAAGATTAAATCTAAGG
TTCAATGCCAACGAGTTCAAGCAGTATGACTCTAAGGAGACAGGGTTGGAACACTTGGTC
GCCCTTGCAGAGATCTCTGCAAGAATTGGGGGCACTGATGATGATGAATCAAACAAAACT
GAAGTGGAGTCTGCCTTGAGGACTGCAATTCGCAAGCATCCGACGCCGAGCACTCTTATG
GTTGATATACAATGGGTGGATTGGATCTTTGGTGCTGAAGGGAGAGACTTGGATGAAGAT
TTGGCACAACAAGATGATCACGGGTATGGATTTTTCATTCTATTCCCAGGTTACAACTTA
CAAGGATTATTGAGCTTCTTTCTTTCTCTGCCGTGGCTTCTATCTTTACCTTCTATGCAT
CTTCAACCTGACTTGATGATTGTTTGA

Protein

929 aa

>Os12t0281300-01 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGERKKILLLRGDLRHLLDD
YYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAK
KMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQESYHLGRRTSSSRPREEVDDDD
REDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGV
GKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEV
DRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCG
YNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARH
FKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKE
DYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVV
HHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRS
MAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSISELLQLRYLKITGNITVKLP
EKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKL
NNLRILNIAVMQISQDDLDTLKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCT
APCMTFVEGAMPSVQRLNLRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKT
EVESALRTAIRKHPTPSTLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGYGFFILFPGYNL
QGLLSFFLSLPWLLSLPSMHLQPDLMIV*

5'UTR

chr12:10611771..10611917 (- strand) : 147 bp

CDS

chr12:10610827..10611770 (- strand) : 944 bp

chr12:10607519..10609361 (- strand) : 1843 bp

3'UTR

chr12:10606417..10607518 (- strand) : 1102 bp

FASTA

>Os12t0281300-01 class=Sequence position=chr12:10606417..10611917 (- strand)
ACTAGATAGG ATTAAGTTTC AAGAGTTAAT TTCTTGTACT CTTGGGCGAT CCATGCTGTC AAATCAGCAA CTAACGAGGC
ATAATCTCGA TCACTAGCTC TGATCTGATC TTCAGCTAGC GCCGGCGAGC TGCAGAGGTC TCCATCCATG GCGCCGGCGG
TCAGTGCATC GCAGGGTGTC ATCATGCGGT CCCTGACGAG CAAGCTCGAC TCGCTGCTGC TGCAGCCGCC GGAGCCGCCG
CCGCCTGCGC AACCGTCGTC GCTGCGGAAG GGGGAGAGGA AGAAGATCCT CCTCCTCAGA GGCGATCTCC GACACCTGCT
AGATGACTAC TACCTCCTCG TGGAGCCGCC GTCAGACACC GCGCCACCGC CAGACTCGAC GGCGGCGTGC TGGGCTAAGG
AGGTTCGCGA GCTCTCCTAC GACGTCGACG ACTTCCTCGA CGAGCTAACG ACCCAGCTCC TCCACCACCG CGGCGGCGGC
GATGGCAGTA GCACTGCTGG TGCCAAGAAG ATGATCAGCA GCATGATCGC CCGGCTTCGA GGGGAGCTTA ACCGGCGGCG
GTGGATCGCC GACGAGGTCA CCCTGTTCAG CGCCCGCGTG AAGGAGGCCA TTCGCCGCCA GGAGAGCTAC CATCTTGGCA
GGCGCACCTC GAGCTCGAGG CCGAGAGAAG AAGTCGACGA CGACGATCGC GAGGACTCCG CCGGCAACGA ACGCCGCCGG
TTTCTGTCGC TGACGTTCGG GATGGACGAC GCTGCTGTGC ACGGCCAGCT CGTTGGTAGG GATATTTCGA TGCAAAAGCT
CGTCCGGTGG CTGGCCGACG GCGAGCCGAA Gctcaaggtg gcttccattg ttggatccgg aggtgttggc aagacgacgc
tggcCACAGA ATTCTATCGT CTGCATGGCC GGCGGTTGGA TGCGCCGTTC GACTGCCGGG CTTTCGTGCG GACGCCCCGG
AAGCCTGACA TGACGAAGAT CCTCACCGAC ATGCTGTCAC AGCTGCGGCC ACAACATCAG CATCAGTCTT CGGATGTTTG
GGAGGTTGAT CGACTCCTTG AAACTATCCG GACGCATTTG CAAGATAAAA GGTAATTCAT GTCTACATCT ATCTCTAGTA
TTTTTTTCAT GAATTTACAA ACTATTTTCT CAAATTTCCC CTTTTTTATC CTTCATATAG TAATTAAGTT AGTAACTATA
CATATGAATT TAATTTACTC GACAATGCCA ATAATATTTT AAATTACTTT TATAGTGCCC TCTATTAGTA GATACGATTC
GATCGAGCCA TGAATTATAC TGGTAATCTA AACAATTATT ATACCCACCT CATTCTACTA ACAGCAATTG AGTTGTTAAT
ATAAATAGAT ATGGTCTATT GCATGAAAAA ATAAAGGTAA AGTGTTTACA TTATTTCTAC TACTAGTAGA AGAACTACAA
AGTTGTTTGT ATTTTTAATT ATTAAATGTA AATGAAAGTA TATGTTTCAT ACCCTTGTTA TTTTTTTTAG GCGACTAAAC
TACTAGTACA TTATTTCTAC TACTAGTAGA ACAACTACAA AGTTGTTTGT ATTTTTAATT ACTAAATGTA AATGAAAGTA
CATGCTTCAT ACCCTTGTTA TAATTTTTTA GACTAAACTA CCACAATGGC ATGTTAACTT ATAGCAGTAA GTTGTAATTT
ATTTTCTTTT CATTTTCTCA GTTGTTACAA GAACTTTTTT TTACTTAATA AAAAATAGTC GTAAGGGCCT CCCTTGTTCG
GTCAAAAAAG AATTAGACTA AACTCAATCG TATTTGTACA TAAACAAAAT TTAAAATATA ACTAAAACGA AACAGTGATA
AAAATGGTGC AATTTAACTG ctgcctcttg ttttaatgtc tgacaatgtt gattttgtat atatgtttgg ccatttattt
tattcaaatt ttttacaaat atgaaaaata taatatatgc ttaaattact tttaatgata aaataaattt aaaaaaatga
taattatatt tttaataaga tggatgatct aacatatata tgtccaaaag tttgacatca aacattaaaa ACAAGAGAGA
GTATTTGCTT AGGAGTACGT GTCTTTTTCC ATGTCtaaga acaggtacaa tagcaggtta taagctagct ataaacatat
tttaaagaga tataggaaga gagagaagag cagcagccta cagatctgta gccagctgca gcacggactc taagacgtaa
tgtgtgtatg acaggtagga ccaagtatta atagtatagt aagcaactat tgtatgaatt ggctatttgg ctctagatga
tttggagcta gtagtcggct atactattaa acttgctctt aGATATGTGG TTAAATTTAA TTTCTGAAAT TTACAAGATA
TAGAACATGT CTTCACCATG TTTGCAAAGT TGATAAAATG AAATTGCACt caacttttta aattcagcat gctatcccac
gtatagcttt ttaaatatga tttatttttt cgtacattag aagtttaatg tttacgaagt actaaatgtt ctgcaggtac
ttcatcataa ttgaagattt atgggcttca tcaatgtggg atattgttag ccgtggtttg cctgataata atagttgcag
tagaatacta ataacaacag aaattgaacc tgtagctttg gcatgctgtg gatataactc agagcacatt attaagattg
atccactggg tgatgatgtc tcaagtcaat tgtttttcag tggagttgtt ggccaaggaa atgaatttcc tggacatctt
actgaagttt ctcatgacat gataaaaaaa tgtggtggct tgccactagc aataactata acagccagac attttaaaag
ccagctgtta gatggaatgc agcaatggaa tcacatacaa aaatcattga ctacttccaa tttgaagaaa aatcctactt
tgcaggggat gaggcaagta ctcaacctta tttacaataa tcttcctcat tgtttgaaag catgtctgtt ataccttagc
atctacaaag aggactacat aattaggaag gccaacttgg tgaggcaatg gatggctgaa ggtttcatca attccataga
aaataaagtc atggaagaag ttgcagggaa ctattttgat gaacttgttg gtaggggcct ggtccaacca gtagatgtta
actgcaaaaa tgaggtattg tcatgtgtag tgcaccacat ggtattaaat ttcatcaggt gtaagtcaat agaggagaat
ttcagcatta cattggatca ttctcagacg acagtaagac atgctgacaa ggttcgccga ctctcgcttc acttcagcaa
tgcacatgat acaacaccac tagcaggttt gagactctca caagttcgat cgatggcatt tttcggacaa gtcaagtgta
tgccttccat tgcagattat aggcttcttc gagttctgat tctttgtttt tgggctgatc aagagaaaac aagctatgac
ctcacaagca tttctgaact gttacaactg agatatctga agataacagg taatATCACA GTTAAACTTC CAGAGAAGAT
CCAAGGACTA CAACACTTGC AGACACTGGA AGCAGATGCA AGAGCAACTG CTGTCCTATT GGATATTGTT CATACACAGT
GTTTGTTGCA CCTTCGTCTT GTACTACTTG ATCTGCTCCC TCACTGTCAC AGGTACATCT TCACCAGCAT CCCCAAATGG
ACTGGAAAGC TCAACAATCT CCGCATTTTA AACATTGCAG TCATGCAAAT TTCCCAGGAT GACCTTGACA CTCTCAAAGG
ACTGGGATCT CTCACTGCTC TTTCGCTGCT TGTTCGAACA GCGCCTGCGC AAAGAATCGT CGCTGCGAAT GAGGGGTTCG
GGTCTCTCAA GTACTTCATG TTTGTCTGTA CAGCACCATG CATGACTTTT GTGGAAGGAG CAATGCCGAG TGTGCAAAGA
TTAAATCTAA GGTTCAATGC CAACGAGTTC AAGCAGTATG ACTCTAAGGA GACAGGGTTG GAACACTTGG TCGCCCTTGC
AGAGATCTCT GCAAGAATTG GGGGCACTGA TGATGATGAA TCAAACAAAA CTGAAGTGGA GTCTGCCTTG AGGACTGCAA
TTCGCAAGCA TCCGACGCCG AGCACTCTTA TGGTTGATAT ACAATGGGTG GATTGGATCT TTGGTGCTGA AGGGAGAGAC
TTGGATGAAG ATTTGGCACA ACAAGATGAT CACGGGTATG GATTTTTCAT TCTATTCCCA GGTTACAACT TACAAGGATT
ATTGAGCTTC TTTCTTTCTC TGCCGTGGCT TCTATCTTTA CCTTCTATGC ATCTTCAACC TGACTTGATG ATTGTTTGAA
ACCAATTTTA ATGGAAGTTA AATGTTATTG TTGTGACCCT GAATCAGGTT TTGTATGCTA CCGGAATCCT CTTCACGTCT
TCAGAGTAGA GGTAATTTTG TTTCTTGTCA TTTTACAGTT ACAGTTCATC TACTTAAGGA ATTAATGGGA GGTCCTATAT
TTTCTCGGGT ACCTAGAAGG TGTGGTTCCT AGTCTTACCT CCTTAAGAAC CGTAGAATGT TGGCCCTAAC ACTTGGATCA
AAGAACGAAA GGTGTATGCA CTATAGTATC CTTTATATAT TGCACAAGTC AAGACATTTG TTAAAACACA CCCAGTGCTA
GTAATTTGTT TACTGAGATA TGAATTATCG CCAAATACCC ATACTGAGCC TATTAGTAAA ATATTTACGA GGTGTTTGAG
GACAGCATAA CTTTCAGTAA AGAATTTACT ACGTGAGGTG TGTGTTTTAG GTATTGCGCA TCTTGGGTGC ATTTTAGCGC
AAACGTGTAT AATATATATC CCATGGTACT AACTCATGTC TTAACCATAA TTGCACACCA ACACAAAACA TACACTACTA
CAGAGATAAG TATCGAAGAA GACATGCCCA CCGGTGCGGA AGGGACGGTG ATTGTGCCCC ACACAATGGA GCAGTTCGCC
CTCCACATGA GCCAAGCCAA GCAATCCCAC AAGCTCGTAG TCATCCAGTT CACTACTTCC CGGTGCCCTG CTTCACGCTA
CATCGCGCCA GCTTTCACCG AGTATGCGAA GGAGTTCGCT GGTGCGGTTT TCATTAAGGT CAATGTCGAC AGCGATGAGC
TGGAGAGTGT TACGGACTGG TATGACATCG AAGGGATAGT GCCAACATTT TTCTTCGTCA AGGATGGGGA GAAGATTGAC
AAGATTCCTG GTGCTAACAA GGAGTTGCTC CGAGCCAAAA TTCGAAGGCA CACAGCTTCT CCTTACTTCC TCCGTTGATA
ATGACTTCTT TTATCGTCTT TGTCTAGTAT ATATATGGCA CTTATATAGT TAACTAGGAA GGGCACCTTG TTTAATGTAG
CTTTCATTTT TATTATGAAT GTTAAGGATG ATATTATATT GTTGAAGTAT TTTTTTACTC C