Os12t0281300-02

Locus

Os12g0281300

Description

Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)

RAP-DB Gene Symbol Synonym(s)

Pi-ta

RAP-DB Gene Name Synonym(s)

Pyricularia oryzae resistance-ta

CGSNL Gene Symbol

PITA

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE TA

Oryzabase Gene Symbol Synonym(s)

Pita, Pita (sl, Pi4a, Pi-ta), Pita2, Pi4a, Pita, Pi-ta, Pita-2, Pi-ta2, Pi-4(t), Pi-4, Pi4, Pi-4a(t), OsTRXh6, TRXh6, OsTrx30

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance-ta, Magnaporthe grisea resistance-ta, Blast resistance ta, Thioredoxin H-type 6, H-type Thioredoxin 6, Thioredoxin 30

Transcript Evidence

AK071926

Protein Evidence

Q2QTV8

Literature

DOI: 10.1016/j.plantsci.2009.07.012

Note

Manual Curation

July 26, 2018

Gene Ontology (GO)

Biological Process: cell redox homeostasis (GO:0045454)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Leucine-rich repeat domain superfamily (IPR032675)

Thioredoxin-like superfamily (IPR036249)

NB-ARC (IPR002182)

Thioredoxin domain (IPR013766)

Full-length cDNA

J013072F24 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0281300-02)

Others

Oryzabase (947)

Transcript

3447 bp

>Os12t0281300-02 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
AGATAGGATTAAGTTTCAAGAGTTAATTTCTTGTACTCTTGGGCGATCCATGCTGTCAAA
TCAGCAACTAACGAGGCATAATCTCGATCACTAGCTCTGATCTGATCTTCAGCTAGCGCC
GGCGAGCTGCAGAGGTCTCCATCCATGGCGCCGGCGGTCAGTGCATCGCAGGGTGTCATC
ATGCGGTCCCTGACGAGCAAGCTCGACTCGCTGCTGCTGCAGCCGCCGGAGCCGCCGCCG
CCTGCGCAACCGTCGTCGCTGCGGAAGGGGGAGAGGAAGAAGATCCTCCTCCTCAGAGGC
GATCTCCGACACCTGCTAGATGACTACTACCTCCTCGTGGAGCCGCCGTCAGACACCGCG
CCACCGCCAGACTCGACGGCGGCGTGCTGGGCTAAGGAGGTTCGCGAGCTCTCCTACGAC
GTCGACGACTTCCTCGACGAGCTAACGACCCAGCTCCTCCACCACCGCGGCGGCGGCGAT
GGCAGTAGCACTGCTGGTGCCAAGAAGATGATCAGCAGCATGATCGCCCGGCTTCGAGGG
GAGCTTAACCGGCGGCGGTGGATCGCCGACGAGGTCACCCTGTTCAGCGCCCGCGTGAAG
GAGGCCATTCGCCGCCAGGAGAGCTACCATCTTGGCAGGCGCACCTCGAGCTCGAGGCCG
AGAGAAGAAGTCGACGACGACGATCGCGAGGACTCCGCCGGCAACGAACGCCGCCGGTTT
CTGTCGCTGACGTTCGGGATGGACGACGCTGCTGTGCACGGCCAGCTCGTTGGTAGGGAT
ATTTCGATGCAAAAGCTCGTCCGGTGGCTGGCCGACGGCGAGCCGAAGctcaaggtggct
tccattgttggatccggaggtgttggcaagacgacgctggcCACAGAATTCTATCGTCTG
CATGGCCGGCGGTTGGATGCGCCGTTCGACTGCCGGGCTTTCGTGCGGACGCCCCGGAAG
CCTGACATGACGAAGATCCTCACCGACATGCTGTCACAGCTGCGGCCACAACATCAGCAT
CAGTCTTCGGATGTTTGGGAGGTTGATCGACTCCTTGAAACTATCCGGACGCATTTGCAA
GATAAAAGgtacttcatcataattgaagatttatgggcttcatcaatgtgggatattgtt
agccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaattgaa
cctgtagctttggcatgctgtggatataactcagagcacattattaagattgatccactg
ggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaattt
cctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgccacta
gcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaatgg
aatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcagggg
atgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgtctg
ttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgaggcaa
tggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgcaggg
aactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgcaaa
aatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaagtca
atagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgctgac
aaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagcaggt
ttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgccttcc
attgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagagaaa
acaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagataaca
ggtaatATCACAGTTAAACTTCCAGAGAAGATCCAAGGACTACAACACTTGCAGACACTG
GAAGCAGATGCAAGAGCAACTGCTGTCCTATTGGATATTGTTCATACACAGTGTTTGTTG
CACCTTCGTCTTGTACTACTTGATCTGCTCCCTCACTGTCACAGGTACATCTTCACCAGC
ATCCCCAAATGGACTGGAAAGCTCAACAATCTCCGCATTTTAAACATTGCAGTCATGCAA
ATTTCCCAGGATGACCTTGACACTCTCAAAGGACTGGGATCTCTCACTGCTCTTTCGCTG
CTTGTTCGAACAGCGCCTGCGCAAAGAATCGTCGCTGCGAATGAGGGGTTCGGGTCTCTC
AAGTACTTCATGTTTGTCTGTACAGCACCATGCATGACTTTTGTGGAAGGAGCAATGCCG
AGTGTGCAAAGATTAAATCTAAGGTTCAATGCCAACGAGTTCAAGCAGTATGACTCTAAG
GAGACAGGGTTGGAACACTTGGTCGCCCTTGCAGAGATCTCTGCAAGAATTGGGGGCACT
GATGATGATGAATCAAACAAAACTGAAGTGGAGTCTGCCTTGAGGACTGCAATTCGCAAG
CATCCGACGCCGAGCACTCTTATGGTTGATATACAATGGGTGGATTGGATCTTTGGTGCT
GAAGGGAGAGACTTGGATGAAGATTTGGCACAACAAGATGATCACGGGTTTTGTATGCTA
CCGGAATCCTCTTCACGTCTTCAGAGTAGAGAGATAAGTATCGAAGAAGACATGCCCACC
GGTGCGGAAGGGACGGTGATTGTGCCCCACACAATGGAGCAGTTCGCCCTCCACATGAGC
CAAGCCAAGCAATCCCACAAGCTCGTAGTCATCCAGTTCACTACTTCCCGGTGCCCTGCT
TCACGCTACATCGCGCCAGCTTTCACCGAGTATGCGAAGGAGTTCGCTGGTGCGGTTTTC
ATTAAGGTCAATGTCGACAGCGATGAGCTGGAGAGTGTTACGGACTGGTATGACATCGAA
GGGATAGTGCCAACATTTTTCTTCGTCAAGGATGGGGAGAAGATTGACAAGATTCCTGGT
GCTAACAAGGAGTTGCTCCGAGCCAAAATTCGAAGGCACACAGCTTCTCCTTACTTCCTC
CGTTGATAATGACTTCTTTTATCGTCTTTGTCTAGTATATATATGGCACTTATATAGTTA
ACTAGGAAGGGCACCTTGTTTAATGTAGCTTTCATTTTTATTATGAATGTTAAGGATGAT
ATTATATTGTTGAAGTATTTTTTTACTCCTTGTAAACATGTATTGGTTAATAACGAAGTA
GTTTGGACATTAGTTATGATTTTCTTC

CDS

3102 bp

>Os12t0281300-02 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
ATGGCGCCGGCGGTCAGTGCATCGCAGGGTGTCATCATGCGGTCCCTGACGAGCAAGCTC
GACTCGCTGCTGCTGCAGCCGCCGGAGCCGCCGCCGCCTGCGCAACCGTCGTCGCTGCGG
AAGGGGGAGAGGAAGAAGATCCTCCTCCTCAGAGGCGATCTCCGACACCTGCTAGATGAC
TACTACCTCCTCGTGGAGCCGCCGTCAGACACCGCGCCACCGCCAGACTCGACGGCGGCG
TGCTGGGCTAAGGAGGTTCGCGAGCTCTCCTACGACGTCGACGACTTCCTCGACGAGCTA
ACGACCCAGCTCCTCCACCACCGCGGCGGCGGCGATGGCAGTAGCACTGCTGGTGCCAAG
AAGATGATCAGCAGCATGATCGCCCGGCTTCGAGGGGAGCTTAACCGGCGGCGGTGGATC
GCCGACGAGGTCACCCTGTTCAGCGCCCGCGTGAAGGAGGCCATTCGCCGCCAGGAGAGC
TACCATCTTGGCAGGCGCACCTCGAGCTCGAGGCCGAGAGAAGAAGTCGACGACGACGAT
CGCGAGGACTCCGCCGGCAACGAACGCCGCCGGTTTCTGTCGCTGACGTTCGGGATGGAC
GACGCTGCTGTGCACGGCCAGCTCGTTGGTAGGGATATTTCGATGCAAAAGCTCGTCCGG
TGGCTGGCCGACGGCGAGCCGAAGctcaaggtggcttccattgttggatccggaggtgtt
ggcaagacgacgctggcCACAGAATTCTATCGTCTGCATGGCCGGCGGTTGGATGCGCCG
TTCGACTGCCGGGCTTTCGTGCGGACGCCCCGGAAGCCTGACATGACGAAGATCCTCACC
GACATGCTGTCACAGCTGCGGCCACAACATCAGCATCAGTCTTCGGATGTTTGGGAGGTT
GATCGACTCCTTGAAACTATCCGGACGCATTTGCAAGATAAAAGgtacttcatcataatt
gaagatttatgggcttcatcaatgtgggatattgttagccgtggtttgcctgataataat
agttgcagtagaatactaataacaacagaaattgaacctgtagctttggcatgctgtgga
tataactcagagcacattattaagattgatccactgggtgatgatgtctcaagtcaattg
tttttcagtggagttgttggccaaggaaatgaatttcctggacatcttactgaagtttct
catgacatgataaaaaaatgtggtggcttgccactagcaataactataacagccagacat
tttaaaagccagctgttagatggaatgcagcaatggaatcacatacaaaaatcattgact
acttccaatttgaagaaaaatcctactttgcaggggatgaggcaagtactcaaccttatt
tacaataatcttcctcattgtttgaaagcatgtctgttataccttagcatctacaaagag
gactacataattaggaaggccaacttggtgaggcaatggatggctgaaggtttcatcaat
tccatagaaaataaagtcatggaagaagttgcagggaactattttgatgaacttgttggt
aggggcctggtccaaccagtagatgttaactgcaaaaatgaggtattgtcatgtgtagtg
caccacatggtattaaatttcatcaggtgtaagtcaatagaggagaatttcagcattaca
ttggatcattctcagacgacagtaagacatgctgacaaggttcgccgactctcgcttcac
ttcagcaatgcacatgatacaacaccactagcaggtttgagactctcacaagttcgatcg
atggcatttttcggacaagtcaagtgtatgccttccattgcagattataggcttcttcga
gttctgattctttgtttttgggctgatcaagagaaaacaagctatgacctcacaagcatt
tctgaactgttacaactgagatatctgaagataacaggtaatATCACAGTTAAACTTCCA
GAGAAGATCCAAGGACTACAACACTTGCAGACACTGGAAGCAGATGCAAGAGCAACTGCT
GTCCTATTGGATATTGTTCATACACAGTGTTTGTTGCACCTTCGTCTTGTACTACTTGAT
CTGCTCCCTCACTGTCACAGGTACATCTTCACCAGCATCCCCAAATGGACTGGAAAGCTC
AACAATCTCCGCATTTTAAACATTGCAGTCATGCAAATTTCCCAGGATGACCTTGACACT
CTCAAAGGACTGGGATCTCTCACTGCTCTTTCGCTGCTTGTTCGAACAGCGCCTGCGCAA
AGAATCGTCGCTGCGAATGAGGGGTTCGGGTCTCTCAAGTACTTCATGTTTGTCTGTACA
GCACCATGCATGACTTTTGTGGAAGGAGCAATGCCGAGTGTGCAAAGATTAAATCTAAGG
TTCAATGCCAACGAGTTCAAGCAGTATGACTCTAAGGAGACAGGGTTGGAACACTTGGTC
GCCCTTGCAGAGATCTCTGCAAGAATTGGGGGCACTGATGATGATGAATCAAACAAAACT
GAAGTGGAGTCTGCCTTGAGGACTGCAATTCGCAAGCATCCGACGCCGAGCACTCTTATG
GTTGATATACAATGGGTGGATTGGATCTTTGGTGCTGAAGGGAGAGACTTGGATGAAGAT
TTGGCACAACAAGATGATCACGGGTTTTGTATGCTACCGGAATCCTCTTCACGTCTTCAG
AGTAGAGAGATAAGTATCGAAGAAGACATGCCCACCGGTGCGGAAGGGACGGTGATTGTG
CCCCACACAATGGAGCAGTTCGCCCTCCACATGAGCCAAGCCAAGCAATCCCACAAGCTC
GTAGTCATCCAGTTCACTACTTCCCGGTGCCCTGCTTCACGCTACATCGCGCCAGCTTTC
ACCGAGTATGCGAAGGAGTTCGCTGGTGCGGTTTTCATTAAGGTCAATGTCGACAGCGAT
GAGCTGGAGAGTGTTACGGACTGGTATGACATCGAAGGGATAGTGCCAACATTTTTCTTC
GTCAAGGATGGGGAGAAGATTGACAAGATTCCTGGTGCTAACAAGGAGTTGCTCCGAGCC
AAAATTCGAAGGCACACAGCTTCTCCTTACTTCCTCCGTTGA

Protein

1034 aa

>Os12t0281300-02 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
MAPAVSASQGVIMRSLTSKLDSLLLQPPEPPPPAQPSSLRKGERKKILLLRGDLRHLLDD
YYLLVEPPSDTAPPPDSTAACWAKEVRELSYDVDDFLDELTTQLLHHRGGGDGSSTAGAK
KMISSMIARLRGELNRRRWIADEVTLFSARVKEAIRRQESYHLGRRTSSSRPREEVDDDD
REDSAGNERRRFLSLTFGMDDAAVHGQLVGRDISMQKLVRWLADGEPKLKVASIVGSGGV
GKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPDMTKILTDMLSQLRPQHQHQSSDVWEV
DRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSRGLPDNNSCSRILITTEIEPVALACCG
YNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPGHLTEVSHDMIKKCGGLPLAITITARH
FKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMRQVLNLIYNNLPHCLKACLLYLSIYKE
DYIIRKANLVRQWMAEGFINSIENKVMEEVAGNYFDELVGRGLVQPVDVNCKNEVLSCVV
HHMVLNFIRCKSIEENFSITLDHSQTTVRHADKVRRLSLHFSNAHDTTPLAGLRLSQVRS
MAFFGQVKCMPSIADYRLLRVLILCFWADQEKTSYDLTSISELLQLRYLKITGNITVKLP
EKIQGLQHLQTLEADARATAVLLDIVHTQCLLHLRLVLLDLLPHCHRYIFTSIPKWTGKL
NNLRILNIAVMQISQDDLDTLKGLGSLTALSLLVRTAPAQRIVAANEGFGSLKYFMFVCT
APCMTFVEGAMPSVQRLNLRFNANEFKQYDSKETGLEHLVALAEISARIGGTDDDESNKT
EVESALRTAIRKHPTPSTLMVDIQWVDWIFGAEGRDLDEDLAQQDDHGFCMLPESSSRLQ
SREISIEEDMPTGAEGTVIVPHTMEQFALHMSQAKQSHKLVVIQFTTSRCPASRYIAPAF
TEYAKEFAGAVFIKVNVDSDELESVTDWYDIEGIVPTFFFVKDGEKIDKIPGANKELLRA
KIRRHTASPYFLR*

5'UTR

chr12:10611771..10611914 (- strand) : 144 bp

CDS

chr12:10610827..10611770 (- strand) : 944 bp

chr12:10607643..10609361 (- strand) : 1719 bp

chr12:10607427..10607470 (- strand) : 44 bp

chr12:10606560..10606954 (- strand) : 395 bp

3'UTR

chr12:10606359..10606559 (- strand) : 201 bp

FASTA

>Os12t0281300-02 class=Sequence position=chr12:10606359..10611914 (- strand)
AGATAGGATT AAGTTTCAAG AGTTAATTTC TTGTACTCTT GGGCGATCCA TGCTGTCAAA TCAGCAACTA ACGAGGCATA
ATCTCGATCA CTAGCTCTGA TCTGATCTTC AGCTAGCGCC GGCGAGCTGC AGAGGTCTCC ATCCATGGCG CCGGCGGTCA
GTGCATCGCA GGGTGTCATC ATGCGGTCCC TGACGAGCAA GCTCGACTCG CTGCTGCTGC AGCCGCCGGA GCCGCCGCCG
CCTGCGCAAC CGTCGTCGCT GCGGAAGGGG GAGAGGAAGA AGATCCTCCT CCTCAGAGGC GATCTCCGAC ACCTGCTAGA
TGACTACTAC CTCCTCGTGG AGCCGCCGTC AGACACCGCG CCACCGCCAG ACTCGACGGC GGCGTGCTGG GCTAAGGAGG
TTCGCGAGCT CTCCTACGAC GTCGACGACT TCCTCGACGA GCTAACGACC CAGCTCCTCC ACCACCGCGG CGGCGGCGAT
GGCAGTAGCA CTGCTGGTGC CAAGAAGATG ATCAGCAGCA TGATCGCCCG GCTTCGAGGG GAGCTTAACC GGCGGCGGTG
GATCGCCGAC GAGGTCACCC TGTTCAGCGC CCGCGTGAAG GAGGCCATTC GCCGCCAGGA GAGCTACCAT CTTGGCAGGC
GCACCTCGAG CTCGAGGCCG AGAGAAGAAG TCGACGACGA CGATCGCGAG GACTCCGCCG GCAACGAACG CCGCCGGTTT
CTGTCGCTGA CGTTCGGGAT GGACGACGCT GCTGTGCACG GCCAGCTCGT TGGTAGGGAT ATTTCGATGC AAAAGCTCGT
CCGGTGGCTG GCCGACGGCG AGCCGAAGct caaggtggct tccattgttg gatccggagg tgttggcaag acgacgctgg
cCACAGAATT CTATCGTCTG CATGGCCGGC GGTTGGATGC GCCGTTCGAC TGCCGGGCTT TCGTGCGGAC GCCCCGGAAG
CCTGACATGA CGAAGATCCT CACCGACATG CTGTCACAGC TGCGGCCACA ACATCAGCAT CAGTCTTCGG ATGTTTGGGA
GGTTGATCGA CTCCTTGAAA CTATCCGGAC GCATTTGCAA GATAAAAGGT AATTCATGTC TACATCTATC TCTAGTATTT
TTTTCATGAA TTTACAAACT ATTTTCTCAA ATTTCCCCTT TTTTATCCTT CATATAGTAA TTAAGTTAGT AACTATACAT
ATGAATTTAA TTTACTCGAC AATGCCAATA ATATTTTAAA TTACTTTTAT AGTGCCCTCT ATTAGTAGAT ACGATTCGAT
CGAGCCATGA ATTATACTGG TAATCTAAAC AATTATTATA CCCACCTCAT TCTACTAACA GCAATTGAGT TGTTAATATA
AATAGATATG GTCTATTGCA TGAAAAAATA AAGGTAAAGT GTTTACATTA TTTCTACTAC TAGTAGAAGA ACTACAAAGT
TGTTTGTATT TTTAATTATT AAATGTAAAT GAAAGTATAT GTTTCATACC CTTGTTATTT TTTTTAGGCG ACTAAACTAC
TAGTACATTA TTTCTACTAC TAGTAGAACA ACTACAAAGT TGTTTGTATT TTTAATTACT AAATGTAAAT GAAAGTACAT
GCTTCATACC CTTGTTATAA TTTTTTAGAC TAAACTACCA CAATGGCATG TTAACTTATA GCAGTAAGTT GTAATTTATT
TTCTTTTCAT TTTCTCAGTT GTTACAAGAA CTTTTTTTTA CTTAATAAAA AATAGTCGTA AGGGCCTCCC TTGTTCGGTC
AAAAAAGAAT TAGACTAAAC TCAATCGTAT TTGTACATAA ACAAAATTTA AAATATAACT AAAACGAAAC AGTGATAAAA
ATGGTGCAAT TTAACTGctg cctcttgttt taatgtctga caatgttgat tttgtatata tgtttggcca tttattttat
tcaaattttt tacaaatatg aaaaatataa tatatgctta aattactttt aatgataaaa taaatttaaa aaaatgataa
ttatattttt aataagatgg atgatctaac atatatatgt ccaaaagttt gacatcaaac attaaaaACA AGAGAGAGTA
TTTGCTTAGG AGTACGTGTC TTTTTCCATG TCtaagaaca ggtacaatag caggttataa gctagctata aacatatttt
aaagagatat aggaagagag agaagagcag cagcctacag atctgtagcc agctgcagca cggactctaa gacgtaatgt
gtgtatgaca ggtaggacca agtattaata gtatagtaag caactattgt atgaattggc tatttggctc tagatgattt
ggagctagta gtcggctata ctattaaact tgctcttaGA TATGTGGTTA AATTTAATTT CTGAAATTTA CAAGATATAG
AACATGTCTT CACCATGTTT GCAAAGTTGA TAAAATGAAA TTGCACtcaa ctttttaaat tcagcatgct atcccacgta
tagcttttta aatatgattt attttttcgt acattagaag tttaatgttt acgaagtact aaatgttctg caggtacttc
atcataattg aagatttatg ggcttcatca atgtgggata ttgttagccg tggtttgcct gataataata gttgcagtag
aatactaata acaacagaaa ttgaacctgt agctttggca tgctgtggat ataactcaga gcacattatt aagattgatc
cactgggtga tgatgtctca agtcaattgt ttttcagtgg agttgttggc caaggaaatg aatttcctgg acatcttact
gaagtttctc atgacatgat aaaaaaatgt ggtggcttgc cactagcaat aactataaca gccagacatt ttaaaagcca
gctgttagat ggaatgcagc aatggaatca catacaaaaa tcattgacta cttccaattt gaagaaaaat cctactttgc
aggggatgag gcaagtactc aaccttattt acaataatct tcctcattgt ttgaaagcat gtctgttata ccttagcatc
tacaaagagg actacataat taggaaggcc aacttggtga ggcaatggat ggctgaaggt ttcatcaatt ccatagaaaa
taaagtcatg gaagaagttg cagggaacta ttttgatgaa cttgttggta ggggcctggt ccaaccagta gatgttaact
gcaaaaatga ggtattgtca tgtgtagtgc accacatggt attaaatttc atcaggtgta agtcaataga ggagaatttc
agcattacat tggatcattc tcagacgaca gtaagacatg ctgacaaggt tcgccgactc tcgcttcact tcagcaatgc
acatgataca acaccactag caggtttgag actctcacaa gttcgatcga tggcattttt cggacaagtc aagtgtatgc
cttccattgc agattatagg cttcttcgag ttctgattct ttgtttttgg gctgatcaag agaaaacaag ctatgacctc
acaagcattt ctgaactgtt acaactgaga tatctgaaga taacaggtaa tATCACAGTT AAACTTCCAG AGAAGATCCA
AGGACTACAA CACTTGCAGA CACTGGAAGC AGATGCAAGA GCAACTGCTG TCCTATTGGA TATTGTTCAT ACACAGTGTT
TGTTGCACCT TCGTCTTGTA CTACTTGATC TGCTCCCTCA CTGTCACAGG TACATCTTCA CCAGCATCCC CAAATGGACT
GGAAAGCTCA ACAATCTCCG CATTTTAAAC ATTGCAGTCA TGCAAATTTC CCAGGATGAC CTTGACACTC TCAAAGGACT
GGGATCTCTC ACTGCTCTTT CGCTGCTTGT TCGAACAGCG CCTGCGCAAA GAATCGTCGC TGCGAATGAG GGGTTCGGGT
CTCTCAAGTA CTTCATGTTT GTCTGTACAG CACCATGCAT GACTTTTGTG GAAGGAGCAA TGCCGAGTGT GCAAAGATTA
AATCTAAGGT TCAATGCCAA CGAGTTCAAG CAGTATGACT CTAAGGAGAC AGGGTTGGAA CACTTGGTCG CCCTTGCAGA
GATCTCTGCA AGAATTGGGG GCACTGATGA TGATGAATCA AACAAAACTG AAGTGGAGTC TGCCTTGAGG ACTGCAATTC
GCAAGCATCC GACGCCGAGC ACTCTTATGG TTGATATACA ATGGGTGGAT TGGATCTTTG GTGCTGAAGG GAGAGACTTG
GATGAAGATT TGGCACAACA AGATGATCAC GGGTATGGAT TTTTCATTCT ATTCCCAGGT TACAACTTAC AAGGATTATT
GAGCTTCTTT CTTTCTCTGC CGTGGCTTCT ATCTTTACCT TCTATGCATC TTCAACCTGA CTTGATGATT GTTTGAAACC
AATTTTAATG GAAGTTAAAT GTTATTGTTG TGACCCTGAA TCAGGTTTTG TATGCTACCG GAATCCTCTT CACGTCTTCA
GAGTAGAGGT AATTTTGTTT CTTGTCATTT TACAGTTACA GTTCATCTAC TTAAGGAATT AATGGGAGGT CCTATATTTT
CTCGGGTACC TAGAAGGTGT GGTTCCTAGT CTTACCTCCT TAAGAACCGT AGAATGTTGG CCCTAACACT TGGATCAAAG
AACGAAAGGT GTATGCACTA TAGTATCCTT TATATATTGC ACAAGTCAAG ACATTTGTTA AAACACACCC AGTGCTAGTA
ATTTGTTTAC TGAGATATGA ATTATCGCCA AATACCCATA CTGAGCCTAT TAGTAAAATA TTTACGAGGT GTTTGAGGAC
AGCATAACTT TCAGTAAAGA ATTTACTACG TGAGGTGTGT GTTTTAGGTA TTGCGCATCT TGGGTGCATT TTAGCGCAAA
CGTGTATAAT ATATATCCCA TGGTACTAAC TCATGTCTTA ACCATAATTG CACACCAACA CAAAACATAC ACTACTACAG
AGATAAGTAT CGAAGAAGAC ATGCCCACCG GTGCGGAAGG GACGGTGATT GTGCCCCACA CAATGGAGCA GTTCGCCCTC
CACATGAGCC AAGCCAAGCA ATCCCACAAG CTCGTAGTCA TCCAGTTCAC TACTTCCCGG TGCCCTGCTT CACGCTACAT
CGCGCCAGCT TTCACCGAGT ATGCGAAGGA GTTCGCTGGT GCGGTTTTCA TTAAGGTCAA TGTCGACAGC GATGAGCTGG
AGAGTGTTAC GGACTGGTAT GACATCGAAG GGATAGTGCC AACATTTTTC TTCGTCAAGG ATGGGGAGAA GATTGACAAG
ATTCCTGGTG CTAACAAGGA GTTGCTCCGA GCCAAAATTC GAAGGCACAC AGCTTCTCCT TACTTCCTCC GTTGATAATG
ACTTCTTTTA TCGTCTTTGT CTAGTATATA TATGGCACTT ATATAGTTAA CTAGGAAGGG CACCTTGTTT AATGTAGCTT
TCATTTTTAT TATGAATGTT AAGGATGATA TTATATTGTT GAAGTATTTT TTTACTCCTT GTAAACATGT ATTGGTTAAT
AACGAAGTAG TTTGGACATT AGTTATGATT TTCTTC