Os12t0281300-03

Locus

Os12g0281300

Description

Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)

RAP-DB Gene Symbol Synonym(s)

Pi-ta

RAP-DB Gene Name Synonym(s)

Pyricularia oryzae resistance-ta

CGSNL Gene Symbol

PITA

CGSNL Gene Name

PYRICULARIA ORYZAE RESISTANCE TA

Oryzabase Gene Symbol Synonym(s)

Pita, Pita (sl, Pi4a, Pi-ta), Pita2, Pi4a, Pita, Pi-ta, Pita-2, Pi-ta2, Pi-4(t), Pi-4, Pi4, Pi-4a(t), OsTRXh6, TRXh6, OsTrx30

Oryzabase Gene Name Synonym(s)

Pyricularia oryzae resistance-ta, Magnaporthe grisea resistance-ta, Blast resistance ta, Thioredoxin H-type 6, H-type Thioredoxin 6, Thioredoxin 30

Transcript Evidence

AK067534

Protein Evidence

A0A0P0Y947

Literature

DOI: 10.1016/j.plantsci.2009.07.012

Note

Manual Curation

July 26, 2018

Gene Ontology (GO)

Biological Process: cell redox homeostasis (GO:0045454)

Molecular Function: ADP binding (GO:0043531)

Functional domain (InterPro)

P-loop containing nucleoside triphosphate hydrolase (IPR027417)

Leucine-rich repeat domain superfamily (IPR032675)

Thioredoxin-like superfamily (IPR036249)

NB-ARC (IPR002182)

Thioredoxin domain (IPR013766)

Full-length cDNA

J013112P19 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0281300-03)

Others

Oryzabase (947)

Transcript

2653 bp

>Os12t0281300-03 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
GATATTTCGATGCAAAAGCTCGTCCGGTGGCTGGCCGACGGCGAGCCGAAGctcaaggtg
gcttccattgttggatccggaggtgttggcaagacgacgctggcCACAGAATTCTATCGT
CTGCATGGCCGGCGGTTGGATGCGCCGTTCGACTGCCGGGCTTTCGTGCGGACGCCCCGG
AAGCCTGACATGACGAAGATCCTCACCGACATGCTGTCACAGCTGCGGCCACAACATCAG
CATCAGTCTTCGGATGTTTGGGAGGTTGATCGACTCCTTGAAACTATCCGGACGCATTTG
CAAGATAAAAGgtacttcatcataattgaagatttatgggcttcatcaatgtgggatatt
gttagccgtggtttgcctgataataatagttgcagtagaatactaataacaacagaaatt
gaacctgtagctttggcatgctgtggatataactcagagcacattattaagattgatcca
ctgggtgatgatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaa
tttcctggacatcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgcca
ctagcaataactataacagccagacattttaaaagccagctgttagatggaatgcagcaa
tggaatcacatacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcag
gggatgaggcaagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgt
ctgttataccttagcatctacaaagaggactacataattaggaaggccaacttggtgagg
caatggatggctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgca
gggaactattttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgc
aaaaatgaggtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaag
tcaatagaggagaatttcagcattacattggatcattctcagacgacagtaagacatgct
gacaaggttcgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagca
ggtttgagactctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgcct
tccattgcagattataggcttcttcgagttctgattctttgtttttgggctgatcaagag
aaaacaagctatgacctcacaagcatttctgaactgttacaactgagatatctgaagata
acaggtaatATCACAGTTAAACTTCCAGAGAAGATCCAAGGACTACAACACTTGCAGACA
CTGGAAGCAGATGCAAGAGCAACTGCTGTCCTATTGGATATTGTTCATACACAGTGTTTG
TTGCACCTTCGTCTTGTACTACTTGATCTGCTCCCTCACTGTCACAGGTACATCTTCACC
AGCATCCCCAAATGGACTGGAAAGCTCAACAATCTCCGCATTTTAAACATTGCAGTCATG
CAAATTTCCCAGGATGACCTTGACACTCTCAAAGGACTGGGATCTCTCACTGCTCTTTCG
CTGCTTGTTCGAACAGCGCCTGCGCAAAGAATCGTCGCTGCGAATGAGGGGTTCGGGTCT
CTCAAGTACTTCATGTTTGTCTGTACAGCACCATGCATGACTTTTGTGGAAGGAGCAATG
CCGAGTGTGCAAAGATTAAATCTAAGGTTCAATGCCAACGAGTTCAAGCAGTATGACTCT
AAGGAGACAGGGTTGGAACACTTGGTCGCCCTTGCAGAGATCTCTGCAAGAATTGGGGGC
ACTGATGATGATGAATCAAACAAAACTGAAGTGGAGTCTGCCTTGAGGACTGCAATTCGC
AAGCATCCGACGCCGAGCACTCTTATGGTTGATATACAATGGGTGGATTGGATCTTTGGT
GCTGAAGGGAGAGACTTGGATGAAGATTTGGCACAACAAGATGATCACGGGTTTTGTATG
CTACCGGAATCCTCTTCACGTCTTCAGAGTAGAGAGATAAGTATCGAAGAAGACATGCCC
ACCGGTGCGGAAGGGACGGTGATTGTGCCCCACACAATGGAGCAGTTCGCCCTCCACATG
AGCCAAGCCAAGCAATCCCACAAGCTCGTAGTCATCCAGTTCACTACTTCCCGGTGCCCT
GCTTCACGCTACATCGCGCCAGCTTTCACCGAGTATGCGAAGGAGTTCGCTGGTGCGGTT
TTCATTAAGGTCAATGTCGACAGCGATGAGCTGGAGAGTGTTACGGACTGGTATGACATC
GAAGGGATAGTGCCAACATTTTTCTTCGTCAAGGATGGGGAGAAGATTGACAAGATTCCT
GGTGCTAACAAGGAGTTGCTCCGAGCCAAAATTCGAAGGCACACAGCTTCTCCTTACTTC
CTCCGTTGATAATGACTTCTTTTATCGTCTTTGTCTAGTATATATATGGCACTTATATAG
TTAACTAGGAAGGGCACCTTGTTTAATGTAGCTTTCATTTTTATTATGAATGTTAAGGAT
GATATTATATTGTTGAAGTATTTTTTTACTCCTTGTAAACATGTATTGGTTAATAACGAA
GTAGTTTGGACAT

CDS

2460 bp

>Os12t0281300-03 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
ATGCAAAAGCTCGTCCGGTGGCTGGCCGACGGCGAGCCGAAGctcaaggtggcttccatt
gttggatccggaggtgttggcaagacgacgctggcCACAGAATTCTATCGTCTGCATGGC
CGGCGGTTGGATGCGCCGTTCGACTGCCGGGCTTTCGTGCGGACGCCCCGGAAGCCTGAC
ATGACGAAGATCCTCACCGACATGCTGTCACAGCTGCGGCCACAACATCAGCATCAGTCT
TCGGATGTTTGGGAGGTTGATCGACTCCTTGAAACTATCCGGACGCATTTGCAAGATAAA
AGgtacttcatcataattgaagatttatgggcttcatcaatgtgggatattgttagccgt
ggtttgcctgataataatagttgcagtagaatactaataacaacagaaattgaacctgta
gctttggcatgctgtggatataactcagagcacattattaagattgatccactgggtgat
gatgtctcaagtcaattgtttttcagtggagttgttggccaaggaaatgaatttcctgga
catcttactgaagtttctcatgacatgataaaaaaatgtggtggcttgccactagcaata
actataacagccagacattttaaaagccagctgttagatggaatgcagcaatggaatcac
atacaaaaatcattgactacttccaatttgaagaaaaatcctactttgcaggggatgagg
caagtactcaaccttatttacaataatcttcctcattgtttgaaagcatgtctgttatac
cttagcatctacaaagaggactacataattaggaaggccaacttggtgaggcaatggatg
gctgaaggtttcatcaattccatagaaaataaagtcatggaagaagttgcagggaactat
tttgatgaacttgttggtaggggcctggtccaaccagtagatgttaactgcaaaaatgag
gtattgtcatgtgtagtgcaccacatggtattaaatttcatcaggtgtaagtcaatagag
gagaatttcagcattacattggatcattctcagacgacagtaagacatgctgacaaggtt
cgccgactctcgcttcacttcagcaatgcacatgatacaacaccactagcaggtttgaga
ctctcacaagttcgatcgatggcatttttcggacaagtcaagtgtatgccttccattgca
gattataggcttcttcgagttctgattctttgtttttgggctgatcaagagaaaacaagc
tatgacctcacaagcatttctgaactgttacaactgagatatctgaagataacaggtaat
ATCACAGTTAAACTTCCAGAGAAGATCCAAGGACTACAACACTTGCAGACACTGGAAGCA
GATGCAAGAGCAACTGCTGTCCTATTGGATATTGTTCATACACAGTGTTTGTTGCACCTT
CGTCTTGTACTACTTGATCTGCTCCCTCACTGTCACAGGTACATCTTCACCAGCATCCCC
AAATGGACTGGAAAGCTCAACAATCTCCGCATTTTAAACATTGCAGTCATGCAAATTTCC
CAGGATGACCTTGACACTCTCAAAGGACTGGGATCTCTCACTGCTCTTTCGCTGCTTGTT
CGAACAGCGCCTGCGCAAAGAATCGTCGCTGCGAATGAGGGGTTCGGGTCTCTCAAGTAC
TTCATGTTTGTCTGTACAGCACCATGCATGACTTTTGTGGAAGGAGCAATGCCGAGTGTG
CAAAGATTAAATCTAAGGTTCAATGCCAACGAGTTCAAGCAGTATGACTCTAAGGAGACA
GGGTTGGAACACTTGGTCGCCCTTGCAGAGATCTCTGCAAGAATTGGGGGCACTGATGAT
GATGAATCAAACAAAACTGAAGTGGAGTCTGCCTTGAGGACTGCAATTCGCAAGCATCCG
ACGCCGAGCACTCTTATGGTTGATATACAATGGGTGGATTGGATCTTTGGTGCTGAAGGG
AGAGACTTGGATGAAGATTTGGCACAACAAGATGATCACGGGTTTTGTATGCTACCGGAA
TCCTCTTCACGTCTTCAGAGTAGAGAGATAAGTATCGAAGAAGACATGCCCACCGGTGCG
GAAGGGACGGTGATTGTGCCCCACACAATGGAGCAGTTCGCCCTCCACATGAGCCAAGCC
AAGCAATCCCACAAGCTCGTAGTCATCCAGTTCACTACTTCCCGGTGCCCTGCTTCACGC
TACATCGCGCCAGCTTTCACCGAGTATGCGAAGGAGTTCGCTGGTGCGGTTTTCATTAAG
GTCAATGTCGACAGCGATGAGCTGGAGAGTGTTACGGACTGGTATGACATCGAAGGGATA
GTGCCAACATTTTTCTTCGTCAAGGATGGGGAGAAGATTGACAAGATTCCTGGTGCTAAC
AAGGAGTTGCTCCGAGCCAAAATTCGAAGGCACACAGCTTCTCCTTACTTCCTCCGTTGA

Protein

820 aa

>Os12t0281300-03 Pi-ta protein belonging to the nucleotide-binding site leucine-rich repeat (NBS-LRR) class, Rice blast resistance (Nipponbare: susceptible)
MQKLVRWLADGEPKLKVASIVGSGGVGKTTLATEFYRLHGRRLDAPFDCRAFVRTPRKPD
MTKILTDMLSQLRPQHQHQSSDVWEVDRLLETIRTHLQDKRYFIIIEDLWASSMWDIVSR
GLPDNNSCSRILITTEIEPVALACCGYNSEHIIKIDPLGDDVSSQLFFSGVVGQGNEFPG
HLTEVSHDMIKKCGGLPLAITITARHFKSQLLDGMQQWNHIQKSLTTSNLKKNPTLQGMR
QVLNLIYNNLPHCLKACLLYLSIYKEDYIIRKANLVRQWMAEGFINSIENKVMEEVAGNY
FDELVGRGLVQPVDVNCKNEVLSCVVHHMVLNFIRCKSIEENFSITLDHSQTTVRHADKV
RRLSLHFSNAHDTTPLAGLRLSQVRSMAFFGQVKCMPSIADYRLLRVLILCFWADQEKTS
YDLTSISELLQLRYLKITGNITVKLPEKIQGLQHLQTLEADARATAVLLDIVHTQCLLHL
RLVLLDLLPHCHRYIFTSIPKWTGKLNNLRILNIAVMQISQDDLDTLKGLGSLTALSLLV
RTAPAQRIVAANEGFGSLKYFMFVCTAPCMTFVEGAMPSVQRLNLRFNANEFKQYDSKET
GLEHLVALAEISARIGGTDDDESNKTEVESALRTAIRKHPTPSTLMVDIQWVDWIFGAEG
RDLDEDLAQQDDHGFCMLPESSSRLQSREISIEEDMPTGAEGTVIVPHTMEQFALHMSQA
KQSHKLVVIQFTTSRCPASRYIAPAFTEYAKEFAGAVFIKVNVDSDELESVTDWYDIEGI
VPTFFFVKDGEKIDKIPGANKELLRAKIRRHTASPYFLR*

5'UTR

chr12:10611129..10611137 (- strand) : 9 bp

CDS

chr12:10610827..10611128 (- strand) : 302 bp

chr12:10607643..10609361 (- strand) : 1719 bp

chr12:10607427..10607470 (- strand) : 44 bp

chr12:10606560..10606954 (- strand) : 395 bp

3'UTR

chr12:10606376..10606559 (- strand) : 184 bp

FASTA

>Os12t0281300-03 class=Sequence position=chr12:10606376..10611137 (- strand)
GATATTTCGA TGCAAAAGCT CGTCCGGTGG CTGGCCGACG GCGAGCCGAA Gctcaaggtg gcttccattg ttggatccgg
aggtgttggc aagacgacgc tggcCACAGA ATTCTATCGT CTGCATGGCC GGCGGTTGGA TGCGCCGTTC GACTGCCGGG
CTTTCGTGCG GACGCCCCGG AAGCCTGACA TGACGAAGAT CCTCACCGAC ATGCTGTCAC AGCTGCGGCC ACAACATCAG
CATCAGTCTT CGGATGTTTG GGAGGTTGAT CGACTCCTTG AAACTATCCG GACGCATTTG CAAGATAAAA GGTAATTCAT
GTCTACATCT ATCTCTAGTA TTTTTTTCAT GAATTTACAA ACTATTTTCT CAAATTTCCC CTTTTTTATC CTTCATATAG
TAATTAAGTT AGTAACTATA CATATGAATT TAATTTACTC GACAATGCCA ATAATATTTT AAATTACTTT TATAGTGCCC
TCTATTAGTA GATACGATTC GATCGAGCCA TGAATTATAC TGGTAATCTA AACAATTATT ATACCCACCT CATTCTACTA
ACAGCAATTG AGTTGTTAAT ATAAATAGAT ATGGTCTATT GCATGAAAAA ATAAAGGTAA AGTGTTTACA TTATTTCTAC
TACTAGTAGA AGAACTACAA AGTTGTTTGT ATTTTTAATT ATTAAATGTA AATGAAAGTA TATGTTTCAT ACCCTTGTTA
TTTTTTTTAG GCGACTAAAC TACTAGTACA TTATTTCTAC TACTAGTAGA ACAACTACAA AGTTGTTTGT ATTTTTAATT
ACTAAATGTA AATGAAAGTA CATGCTTCAT ACCCTTGTTA TAATTTTTTA GACTAAACTA CCACAATGGC ATGTTAACTT
ATAGCAGTAA GTTGTAATTT ATTTTCTTTT CATTTTCTCA GTTGTTACAA GAACTTTTTT TTACTTAATA AAAAATAGTC
GTAAGGGCCT CCCTTGTTCG GTCAAAAAAG AATTAGACTA AACTCAATCG TATTTGTACA TAAACAAAAT TTAAAATATA
ACTAAAACGA AACAGTGATA AAAATGGTGC AATTTAACTG ctgcctcttg ttttaatgtc tgacaatgtt gattttgtat
atatgtttgg ccatttattt tattcaaatt ttttacaaat atgaaaaata taatatatgc ttaaattact tttaatgata
aaataaattt aaaaaaatga taattatatt tttaataaga tggatgatct aacatatata tgtccaaaag tttgacatca
aacattaaaa ACAAGAGAGA GTATTTGCTT AGGAGTACGT GTCTTTTTCC ATGTCtaaga acaggtacaa tagcaggtta
taagctagct ataaacatat tttaaagaga tataggaaga gagagaagag cagcagccta cagatctgta gccagctgca
gcacggactc taagacgtaa tgtgtgtatg acaggtagga ccaagtatta atagtatagt aagcaactat tgtatgaatt
ggctatttgg ctctagatga tttggagcta gtagtcggct atactattaa acttgctctt aGATATGTGG TTAAATTTAA
TTTCTGAAAT TTACAAGATA TAGAACATGT CTTCACCATG TTTGCAAAGT TGATAAAATG AAATTGCACt caacttttta
aattcagcat gctatcccac gtatagcttt ttaaatatga tttatttttt cgtacattag aagtttaatg tttacgaagt
actaaatgtt ctgcaggtac ttcatcataa ttgaagattt atgggcttca tcaatgtggg atattgttag ccgtggtttg
cctgataata atagttgcag tagaatacta ataacaacag aaattgaacc tgtagctttg gcatgctgtg gatataactc
agagcacatt attaagattg atccactggg tgatgatgtc tcaagtcaat tgtttttcag tggagttgtt ggccaaggaa
atgaatttcc tggacatctt actgaagttt ctcatgacat gataaaaaaa tgtggtggct tgccactagc aataactata
acagccagac attttaaaag ccagctgtta gatggaatgc agcaatggaa tcacatacaa aaatcattga ctacttccaa
tttgaagaaa aatcctactt tgcaggggat gaggcaagta ctcaacctta tttacaataa tcttcctcat tgtttgaaag
catgtctgtt ataccttagc atctacaaag aggactacat aattaggaag gccaacttgg tgaggcaatg gatggctgaa
ggtttcatca attccataga aaataaagtc atggaagaag ttgcagggaa ctattttgat gaacttgttg gtaggggcct
ggtccaacca gtagatgtta actgcaaaaa tgaggtattg tcatgtgtag tgcaccacat ggtattaaat ttcatcaggt
gtaagtcaat agaggagaat ttcagcatta cattggatca ttctcagacg acagtaagac atgctgacaa ggttcgccga
ctctcgcttc acttcagcaa tgcacatgat acaacaccac tagcaggttt gagactctca caagttcgat cgatggcatt
tttcggacaa gtcaagtgta tgccttccat tgcagattat aggcttcttc gagttctgat tctttgtttt tgggctgatc
aagagaaaac aagctatgac ctcacaagca tttctgaact gttacaactg agatatctga agataacagg taatATCACA
GTTAAACTTC CAGAGAAGAT CCAAGGACTA CAACACTTGC AGACACTGGA AGCAGATGCA AGAGCAACTG CTGTCCTATT
GGATATTGTT CATACACAGT GTTTGTTGCA CCTTCGTCTT GTACTACTTG ATCTGCTCCC TCACTGTCAC AGGTACATCT
TCACCAGCAT CCCCAAATGG ACTGGAAAGC TCAACAATCT CCGCATTTTA AACATTGCAG TCATGCAAAT TTCCCAGGAT
GACCTTGACA CTCTCAAAGG ACTGGGATCT CTCACTGCTC TTTCGCTGCT TGTTCGAACA GCGCCTGCGC AAAGAATCGT
CGCTGCGAAT GAGGGGTTCG GGTCTCTCAA GTACTTCATG TTTGTCTGTA CAGCACCATG CATGACTTTT GTGGAAGGAG
CAATGCCGAG TGTGCAAAGA TTAAATCTAA GGTTCAATGC CAACGAGTTC AAGCAGTATG ACTCTAAGGA GACAGGGTTG
GAACACTTGG TCGCCCTTGC AGAGATCTCT GCAAGAATTG GGGGCACTGA TGATGATGAA TCAAACAAAA CTGAAGTGGA
GTCTGCCTTG AGGACTGCAA TTCGCAAGCA TCCGACGCCG AGCACTCTTA TGGTTGATAT ACAATGGGTG GATTGGATCT
TTGGTGCTGA AGGGAGAGAC TTGGATGAAG ATTTGGCACA ACAAGATGAT CACGGGTATG GATTTTTCAT TCTATTCCCA
GGTTACAACT TACAAGGATT ATTGAGCTTC TTTCTTTCTC TGCCGTGGCT TCTATCTTTA CCTTCTATGC ATCTTCAACC
TGACTTGATG ATTGTTTGAA ACCAATTTTA ATGGAAGTTA AATGTTATTG TTGTGACCCT GAATCAGGTT TTGTATGCTA
CCGGAATCCT CTTCACGTCT TCAGAGTAGA GGTAATTTTG TTTCTTGTCA TTTTACAGTT ACAGTTCATC TACTTAAGGA
ATTAATGGGA GGTCCTATAT TTTCTCGGGT ACCTAGAAGG TGTGGTTCCT AGTCTTACCT CCTTAAGAAC CGTAGAATGT
TGGCCCTAAC ACTTGGATCA AAGAACGAAA GGTGTATGCA CTATAGTATC CTTTATATAT TGCACAAGTC AAGACATTTG
TTAAAACACA CCCAGTGCTA GTAATTTGTT TACTGAGATA TGAATTATCG CCAAATACCC ATACTGAGCC TATTAGTAAA
ATATTTACGA GGTGTTTGAG GACAGCATAA CTTTCAGTAA AGAATTTACT ACGTGAGGTG TGTGTTTTAG GTATTGCGCA
TCTTGGGTGC ATTTTAGCGC AAACGTGTAT AATATATATC CCATGGTACT AACTCATGTC TTAACCATAA TTGCACACCA
ACACAAAACA TACACTACTA CAGAGATAAG TATCGAAGAA GACATGCCCA CCGGTGCGGA AGGGACGGTG ATTGTGCCCC
ACACAATGGA GCAGTTCGCC CTCCACATGA GCCAAGCCAA GCAATCCCAC AAGCTCGTAG TCATCCAGTT CACTACTTCC
CGGTGCCCTG CTTCACGCTA CATCGCGCCA GCTTTCACCG AGTATGCGAA GGAGTTCGCT GGTGCGGTTT TCATTAAGGT
CAATGTCGAC AGCGATGAGC TGGAGAGTGT TACGGACTGG TATGACATCG AAGGGATAGT GCCAACATTT TTCTTCGTCA
AGGATGGGGA GAAGATTGAC AAGATTCCTG GTGCTAACAA GGAGTTGCTC CGAGCCAAAA TTCGAAGGCA CACAGCTTCT
CCTTACTTCC TCCGTTGATA ATGACTTCTT TTATCGTCTT TGTCTAGTAT ATATATGGCA CTTATATAGT TAACTAGGAA
GGGCACCTTG TTTAATGTAG CTTTCATTTT TATTATGAAT GTTAAGGATG ATATTATATT GTTGAAGTAT TTTTTTACTC
CTTGTAAACA TGTATTGGTT AATAACGAAG TAGTTTGGAC AT