Os12t0285100-01

Locus

Os12g0285100

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PTR

CGSNL Gene Name

PI-TA RESISTANCE

Oryzabase Gene Symbol Synonym(s)

Ptr, OsPtr, Ptr(t)

Oryzabase Gene Name Synonym(s)

Pi-ta resistance

Transcript Evidence

AK100362 (DDBJ, Best hit)

Protein Evidence

A2ZJL9 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J023083M12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0285100-01)

RiceXPro (AK100362)

Others

Oryzabase (23458)

KEGG (Os12t0285100-01)

Transcript

4061 bp

>Os12t0285100-01 Hypothetical conserved gene.
CCACCACTGCTTTCCCTCCTCCTCATCCTCATCTTCATCTCTAGACCTCATCTTCTCCAG
CCACCACCGCCTCCCTTCCCACCGGTGGTGGCAGCGGGAAGACAGCGGCTCGGTTGAGCC
CGGCGGGGAGGGCACGATTTGGTATGGGAGGAGCAGCGGCGACTCCATCCGGCGGTGGAT
CCGCCGCCTCCTAGTCCCAGCTCTCTCTCCCCCGATCCTCCTCCTCCCCTTCCTCCACCG
CCACCACCCACCCCTCTCCCTCTCTCAGATCTGGTGCGCGGGGAGCGGTGGAGGCTACGG
CGGCGGCGGCGGCGAGATCGGTAGCAGTGATGGTGGAGAGGACGGATCCGATGGCGGTGG
TTCTCGTCAACCAGTTCAAGGACGACGACAGCAGCGGCTGCTGCAACGATGGATAGGCTC
TGGGCGGCTCCTCCACTCTCCTCCCCTCTCTCATATCCAGTGGCTCGGGGTGGTGGGGCG
TGGCCGACGCATCCGGCGGCGGAGCTCGGGTATCGATCCGGCATGTTTTTTTTTCTCCAA
AATCAATTTTTCTTGGTGGTCGGGAAACGGATTTTCAATTTTCTTTTTTTCGCTCGAATA
TCTTTTTCGCTGGCGGTCAACGTAACTTAACCGCTTGTGAAAACAAGCTTTAAAGTTTcg
ctagtgaagattgttattttcacttgccatttgtttgcgggcggctgacagtgccaccag
cgaaaaACTCTTTTGCTAGTAGTGATTGCTAGATGGTCAGCAGAGAACTTGTGGAGCATA
TGACTATCAACTAACAGTACACTTCAGCAGAAAGAGGATGGTTCTAGCTCTCCGATGGTT
TAATATTGAAACGTACAGCCCACCCACCACCACCCCAGTCGTCCCCAGCTAAGCGCTCCC
TTGCTTGCCTCAGTAGACGAGCTGCCAACTAGTAGCACTCCAGCAAGCAGCGGGTCAGCG
GAGTCCGGAGGGCGCACGTGCGCCGCAGCGAGGTATCAGCATGGCCAGGCGGCGGCTGGC
TGGCCGGCCGGGTTCGGCAAGCGGCTAAGCAGGTAATTAAGGGACTGCAGATACTGCTTG
TGATCATCCCTTAAAATTTCGTCTTTCTTGTCTTGggccaggtttaattcctaatttttt
cttcaaactttcaacttttccatcacatcaaaacttttctacacacacaaactttcaact
taattttccgtcacatcgttccaatttcaatcaaacttctaattttagcgtgaactaaac
acaccctTGGTTGTGACTCTGGGAGTCGATACATAGGCCTTAATGCTCGTAGTTTGTGGA
TTTTGGGGTTAAACTGGCGTGGAACTTTACTTGGATACCACCTGGGAGTTGATGTGATTT
TAGTGTTTAGTACAGTTTAGAGTTTATTACCTACCGGTTTCTTGGTGCCTGGCGCACACT
GAGCATGCAAATGCAGTGAGAGCCAGTATCATCTAAGACGGCTGGACCTGAAATATTTTA
CCATGTATATATCAAACTCGACTTGATCAGGTGTTTAGCGGAGGAAGGATCGATGTCCGG
CGCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGATTGGCCAGAGGT
CTTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTTGTCACCGGGAC
GGGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTCGTCTCCATGCT
ATCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACAAGGTGAGCTAT
CTATAGCCATCTCCACCAGACTTATATTTATTTCGCGTTCCCAACATTAACCAGTTCAGC
CAAGCATTTGGAGTTTCGCATTGCTAGCTAGCTACTAGTTTACTGTCAGATCTAGTGTTG
CGAACCGAATATGCTGCAAAACGTTGCAATTCCAGAGTGGCTTTATATACTACATTGATA
TGAAAATATTCAAGTCCCATATTTGcaaaatcaactatttttaaaatcgaattattttct
ccccttttcaagaagcatgtattttgtatatttctctccccatttgataataatttcatc
aagaattttaaaagagaatataaccaataaagcacaaatgtcatgatttcatgattgtga
catgtaataatcacttcttttttaatttttattttaattttctgaaatttttttgagagc
tttgaagtgtacctaaagcaatgcaattcatggtcatatgttgcaagacaaatgagataa
attcatcaactagttaacaagcatgcattagagtataaacatgaatcaaaggtattacaa
ttaagctcaaatctctactattataaaaattgaagatgtttttgccggtggcttggtaag
tcgtcatgtccgaatTAGCCTCGCACATAATTACTGCCAATTTAATTATTTATGTGCCCC
ACATGTATGAGCTTTAAACATTAGATTTTCCATAAGAAAATTTGCTTGTTCGGATCAGTG
CCTTTGGCCGATTGCGTTTCATCCTGTGCATTGTCACGAACCAACCACCACCGCGAGGTT
GTCATCTTGCTGATACGGTCTGTTCGGCAACACGGTTTGGGACCTGCTGTCGTGCACCTA
TATCAACACCAACCAGCAGCAGTCAGGTGTGTTGCCGTGCGCCGAGGCAAGCAGCACGAC
GTACCATTGTTGATTATTCTCTACACGCACACACCGTATCGAGAAGAATTCCTACTGTGT
TCATCAGAAACTCAATCCAATATTGTCTACTGTGTATACGTGTTCCAAAAAGATTAAAGA
AAAGATCAGGATCGATATCAAAGCCGAGATCTATTACTACCCACATATCGAAAATCCACG
CGTGCAGCAAGACGATCAGCAACAGCAGCCGATCGATGACGGTTGCCAAGAGAAATACGA
AAACCTAATCAGAGAAATATTCAATCAAGCTACTGCGCACATATATCTTTACCTCTTAAA
TTATATTTCTATctctactattataaaaattgtagatgttttcgtcagtattttagtacg
tcatccgcgtatgagtcggtttttaagtccgtttgattttggaaatacaaatccgtattt
gagtcagtttttaagttcgttcgcttttggaaatacagaagaaatcgtataagaaatctc
tttaaaaactcacatactactaacttgagacgttcggacacctaattacagctcatgatt
ttctaacacaatatatatccaagcgaatttgacacagtgaatttcatcttaactcgatat
aatataataagattaaaataatcttcacccgttgcaacacacgggcattttttctagtca
ataataaagataatgatttcaaacgatttataatgcaacatattcacaagtacataggtt
gaaaaaaaatccctatatatatatatatacctattgcatcatcactctttctcaaaataa
cttcttcacaaaaataaccaagagaattttcaacaagtattagagctttttgtgctcatt
ttgacattgataataaaatatctcaatttatttcgagtacgtccgtgtcgttaagaatgt
tctaaggatttggtacccattattttccttactgtaaatacggctttatcgtcaatactg
tttccaaggattctgtattcattttttttctctcatcataagcaactttttattctcctg
tgacatttggaataaacaataagcaatttgaggaataacaatccaataagtataaatata
agcattaatcatccaaactcagcacttgctttaacattgcatatttacttaaatcaagta
aaagaattagtgtcatgcatcatctcacttaaaagtaatatccaagccacatgaaaagac
taaaatgcatacaagctaacatatcaacaaatatacatcaattattttactagcatgcac
aagaatatactagaggtatataccaaagctcttctttttctcattttttttctttatttt
cagatttagagcaatgcatggatatagacatgaatgcaccg

CDS

237 bp

>Os12t0285100-01 Hypothetical conserved gene.
GCTCTGGGCGGCTCCTCCACTCTCCTCCCCTCTCTCATATCCAGTGGCTCGGGGTGGTGG
GGCGTGGCCGACGCATCCGGCGGCGGAGCTCGGGTATCGATCCGGCATGTTTTTTTTTCT
CCAAAATCAATTTTTCTTGGTGGTCGGGAAACGGATTTTCAATTTTCTTTTTTTCGCTCG
AATATCTTTTTCGCTGGCGGTCAACGTAACTTAACCGCTTGTGAAAACAAGCTTTAA

Protein

79 aa

>Os12t0285100-01 Hypothetical conserved gene.
ALGGSSTLLPSLISSGSGWWGVADASGGGARVSIRHVFFSPKSIFLGGRETDFQFSFFRS
NIFFAGGQRNLTACENKL*

5'UTR

chr12:10822535..10822950 (+ strand) : 416 bp

CDS

chr12:10822951..10823187 (+ strand) : 237 bp

3'UTR

chr12:10823188..10826595 (+ strand) : 3408 bp

FASTA

>Os12t0285100-01 class=Sequence position=chr12:10822535..10826595 (+ strand)
CCACCACTGC TTTCCCTCCT CCTCATCCTC ATCTTCATCT CTAGACCTCA TCTTCTCCAG CCACCACCGC CTCCCTTCCC
ACCGGTGGTG GCAGCGGGAA GACAGCGGCT CGGTTGAGCC CGGCGGGGAG GGCACGATTT GGTATGGGAG GAGCAGCGGC
GACTCCATCC GGCGGTGGAT CCGCCGCCTC CTAGTCCCAG CTCTCTCTCC CCCGATCCTC CTCCTCCCCT TCCTCCACCG
CCACCACCCA CCCCTCTCCC TCTCTCAGAT CTGGTGCGCG GGGAGCGGTG GAGGCTACGG CGGCGGCGGC GGCGAGATCG
GTAGCAGTGA TGGTGGAGAG GACGGATCCG ATGGCGGTGG TTCTCGTCAA CCAGTTCAAG GACGACGACA GCAGCGGCTG
CTGCAACGAT GGATAGGCTC TGGGCGGCTC CTCCACTCTC CTCCCCTCTC TCATATCCAG TGGCTCGGGG TGGTGGGGCG
TGGCCGACGC ATCCGGCGGC GGAGCTCGGG TATCGATCCG GCATGTTTTT TTTTCTCCAA AATCAATTTT TCTTGGTGGT
CGGGAAACGG ATTTTCAATT TTCTTTTTTT CGCTCGAATA TCTTTTTCGC TGGCGGTCAA CGTAACTTAA CCGCTTGTGA
AAACAAGCTT TAAAGTTTcg ctagtgaaga ttgttatttt cacttgccat ttgtttgcgg gcggctgaca gtgccaccag
cgaaaaACTC TTTTGCTAGT AGTGATTGCT AGATGGTCAG CAGAGAACTT GTGGAGCATA TGACTATCAA CTAACAGTAC
ACTTCAGCAG AAAGAGGATG GTTCTAGCTC TCCGATGGTT TAATATTGAA ACGTACAGCC CACCCACCAC CACCCCAGTC
GTCCCCAGCT AAGCGCTCCC TTGCTTGCCT CAGTAGACGA GCTGCCAACT AGTAGCACTC CAGCAAGCAG CGGGTCAGCG
GAGTCCGGAG GGCGCACGTG CGCCGCAGCG AGGTATCAGC ATGGCCAGGC GGCGGCTGGC TGGCCGGCCG GGTTCGGCAA
GCGGCTAAGC AGGTAATTAA GGGACTGCAG ATACTGCTTG TGATCATCCC TTAAAATTTC GTCTTTCTTG TCTTGggcca
ggtttaattc ctaatttttt cttcaaactt tcaacttttc catcacatca aaacttttct acacacacaa actttcaact
taattttccg tcacatcgtt ccaatttcaa tcaaacttct aattttagcg tgaactaaac acaccctTGG TTGTGACTCT
GGGAGTCGAT ACATAGGCCT TAATGCTCGT AGTTTGTGGA TTTTGGGGTT AAACTGGCGT GGAACTTTAC TTGGATACCA
CCTGGGAGTT GATGTGATTT TAGTGTTTAG TACAGTTTAG AGTTTATTAC CTACCGGTTT CTTGGTGCCT GGCGCACACT
GAGCATGCAA ATGCAGTGAG AGCCAGTATC ATCTAAGACG GCTGGACCTG AAATATTTTA CCATGTATAT ATCAAACTCG
ACTTGATCAG GTGTTTAGCG GAGGAAGGAT CGATGTCCGG CGCCGGACAG AGCCGTGGTC ATCGCCTTGG ATTACACATT
GATTCGGATT GGCCAGAGGT CTTGTTGATC AATGACTATG CGGTGTTCAT GGGGTACCTG TCGATGGTTG TCACCGGGAC
GGGGTTCCTG GTGCTCACGT GGTCCACCGT CATCCTCCTC GGTGGATTCG TCTCCATGCT ATCCAACAAG GACTTCTGGA
GTCTCACGGT GATCACGCTC GTTCAAACAA GGTGAGCTAT CTATAGCCAT CTCCACCAGA CTTATATTTA TTTCGCGTTC
CCAACATTAA CCAGTTCAGC CAAGCATTTG GAGTTTCGCA TTGCTAGCTA GCTACTAGTT TACTGTCAGA TCTAGTGTTG
CGAACCGAAT ATGCTGCAAA ACGTTGCAAT TCCAGAGTGG CTTTATATAC TACATTGATA TGAAAATATT CAAGTCCCAT
ATTTGcaaaa tcaactattt ttaaaatcga attattttct ccccttttca agaagcatgt attttgtata tttctctccc
catttgataa taatttcatc aagaatttta aaagagaata taaccaataa agcacaaatg tcatgatttc atgattgtga
catgtaataa tcacttcttt tttaattttt attttaattt tctgaaattt ttttgagagc tttgaagtgt acctaaagca
atgcaattca tggtcatatg ttgcaagaca aatgagataa attcatcaac tagttaacaa gcatgcatta gagtataaac
atgaatcaaa ggtattacaa ttaagctcaa atctctacta ttataaaaat tgaagatgtt tttgccggtg gcttggtaag
tcgtcatgtc cgaatTAGCC TCGCACATAA TTACTGCCAA TTTAATTATT TATGTGCCCC ACATGTATGA GCTTTAAACA
TTAGATTTTC CATAAGAAAA TTTGCTTGTT CGGATCAGTG CCTTTGGCCG ATTGCGTTTC ATCCTGTGCA TTGTCACGAA
CCAACCACCA CCGCGAGGTT GTCATCTTGC TGATACGGTC TGTTCGGCAA CACGGTTTGG GACCTGCTGT CGTGCACCTA
TATCAACACC AACCAGCAGC AGTCAGGTGT GTTGCCGTGC GCCGAGGCAA GCAGCACGAC GTACCATTGT TGATTATTCT
CTACACGCAC ACACCGTATC GAGAAGAATT CCTACTGTGT TCATCAGAAA CTCAATCCAA TATTGTCTAC TGTGTATACG
TGTTCCAAAA AGATTAAAGA AAAGATCAGG ATCGATATCA AAGCCGAGAT CTATTACTAC CCACATATCG AAAATCCACG
CGTGCAGCAA GACGATCAGC AACAGCAGCC GATCGATGAC GGTTGCCAAG AGAAATACGA AAACCTAATC AGAGAAATAT
TCAATCAAGC TACTGCGCAC ATATATCTTT ACCTCTTAAA TTATATTTCT ATctctacta ttataaaaat tgtagatgtt
ttcgtcagta ttttagtacg tcatccgcgt atgagtcggt ttttaagtcc gtttgatttt ggaaatacaa atccgtattt
gagtcagttt ttaagttcgt tcgcttttgg aaatacagaa gaaatcgtat aagaaatctc tttaaaaact cacatactac
taacttgaga cgttcggaca cctaattaca gctcatgatt ttctaacaca atatatatcc aagcgaattt gacacagtga
atttcatctt aactcgatat aatataataa gattaaaata atcttcaccc gttgcaacac acgggcattt tttctagtca
ataataaaga taatgatttc aaacgattta taatgcaaca tattcacaag tacataggtt gaaaaaaaat ccctatatat
atatatatac ctattgcatc atcactcttt ctcaaaataa cttcttcaca aaaataacca agagaatttt caacaagtat
tagagctttt tgtgctcatt ttgacattga taataaaata tctcaattta tttcgagtac gtccgtgtcg ttaagaatgt
tctaaggatt tggtacccat tattttcctt actgtaaata cggctttatc gtcaatactg tttccaagga ttctgtattc
attttttttc tctcatcata agcaactttt tattctcctg tgacatttgg aataaacaat aagcaatttg aggaataaca
atccaataag tataaatata agcattaatc atccaaactc agcacttgct ttaacattgc atatttactt aaatcaagta
aaagaattag tgtcatgcat catctcactt aaaagtaata tccaagccac atgaaaagac taaaatgcat acaagctaac
atatcaacaa atatacatca attattttac tagcatgcac aagaatatac tagaggtata taccaaagct cttctttttc
tcattttttt tctttatttt cagatttaga gcaatgcatg gatatagaca tgaatgcacc g