Os12t0285100-02

Locus

Os12g0285100

Description

Atypical resistance protein with Armadillo repeats

RAP-DB Gene Symbol Synonym(s)

Ptr

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK103843 (DDBJ, Best hit)

Protein Evidence

Q0INW2

Literature

PMID: 29795191

Note

Manual Curation

February 19, 2020

Functional domain (InterPro)

Armadillo-type fold (IPR016024)

Experimentally confirmed subcellular location

whole cell

Full-length cDNA

J033148J12 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0285100-02)

Transcript

3461 bp

>Os12t0285100-02 Atypical resistance protein with Armadillo repeats
ACTGCTTTCCCTCCTCCTCATCCTCATCTTCATCTCTAGACCTCATCTTCTCCAGCCACC
ACCGCCTCCCTTCCCACCGGTGGTGGCAGCGGGAAGACAGCGGCTCGGTTGAGCCCGGCG
GGGAGGGCACGATTTGGTATGGGAGGAGCAGCGGCGACTCCATCCGGCGGTGGATCCGCC
GCCTCCTAGTCCCAGCTCTCTCTCCCCCGATCCTCCTCCTCCCCTTCCTCCACCGCCACC
ACCCACCCCTCTCCCTCTCTCAGATCTGGTGCGCGGGGAGCGGTGGAGGCTACGGCGGCG
GCGGCGGCGAGATCGGTAGCAGTGATGGTGGAGAGGACGGATCCGATGGCGGTGGTTCTC
GTCAACCAGTTCAAGGACGACGACAGCAGCGGCTGCTGCAACGATGGATAGGCTCTGGGC
GGCTCCTCCACTCTCCTCCCCTCTCTCATATCCAGTGGCTCGGGGTGGTGGGGCGTGGCC
GACGCATCCGGCGGCGGAGCTCGGCAGAAAGAGGATGGTTCTAGCTCTCCGATGGTTTAA
TATTGAAACGTACAGCCCACCCACCACCACCCCAGTCGTCCCCAGCTAAGCGCTCCCTTG
CTTGCCTCAGTAGACGAGCTGCCAACTAGTAGCACTCCAGCAAGCAGCGGGTCAGCGGAG
TCCGGAGGGCGCACGTGCGCCGCAGCGAGGTATCAGCATGGCCAGGCGGCGGCTGGCTGG
CCGGCCGGGTTCGGCAAGCGGCTAAGCAGGTGTTTAGCGGAGGAAGGATCGATGTCCGGC
GCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGATTGGCCAGAGGTC
TTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTTGTCACCGGGACG
GGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTCGTCTCCATGCTA
TCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACAAGGATATTCGAT
GTTTTTCTGAATGGAAAAGTAAGCCACATTGGGTACTCATTGAAGCGCTTGTGCAAGGCC
GCACGCTTCATCGCGTTGCCCCATAACCATAAGAAGGTTGGGTTCAGGGGTGCTGTTCGA
GTGCTTGTCTTCACCATCGTCTTGTGTCCGCTGTTCCTGCTCTACATGTTTGGGCTCTTC
GTTTCCCCCTGGATTTCGCTGTGGCGTCTAATCCAGCAGGATTACGGCGTGACGGCCGGA
GACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTTCTCTACTCCCTGGCCCTG
TTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGGGAAGAACAGAAGCTAGTG
AAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGCAGTTCAGTTTCGGACTAT
TTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTTGCCAGAGGGAGGAACCTG
ATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGATGGGTACCTTTCAGGTGCA
CGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCATCGGGGAGCGAATTACCG
GGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCCTCCAGTCCCATACTCCAC
AACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGAGAGATCAGGTTGCGAGCC
GCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGACAAAATCCTGCAGGGGATT
CGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTTCAGAATGACCACCATAGT
TCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAAGAGGATGATCACCAGATT
TCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAGATGCAACTTACAGGCATG
CAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTCCTCATGAGCAACACAGAT
GATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCCAAGGGATCACTTCACAAA
AAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTGAAGATACTAAGCCGATTT
ATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTGTGGCATGAAATATCAACA
AGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGTGACCAATGTGACTCTGTG
CTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATGGATACATCTTCGGCTATG
GGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGACATGTCTCTTCACAACAGT
AATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTCAAGAAACAAGGGTTAAGC
ATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGCGAAGGAGACAGAGAAAGG
TTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAGGGCGACTTTGGAAATCTG
CCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATTCTCAAAGAAATATGCATG
GATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTCATCGGCACCCTGATGGAC
ATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTAGCAGGTGATGATCTGGTG
CAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTGAGGAAATATGGTCATGAT
ATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGCAGCATGCACAGAAAAATT
GCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACTGACGAGGAACATCTTCAG
AATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTAAGAGAAGCACTTGGTTGG
GGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGCCTTGAAGGTACCCAAGAT
GATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCAACCGTGTTTAACAGAATT
GTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATCGCCGCTGGTATCTGCGAC
CAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAATGAAGCTGTAAAAGTTCAT
CGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCCAGGCCGGAACTGTACGAG
TTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTGGGCGAGGAAGATCCCAAC
GCGTGTTGTATCTCTTGATAACACCCTAATTTGtactttctccgtttcacaatgtaagtc
attctattatttcctatatttatatggatattaatgaatct

CDS

2607 bp

>Os12t0285100-02 Atypical resistance protein with Armadillo repeats
ATGTCCGGCGCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGATTGG
CCAGAGGTCTTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTTGTC
ACCGGGACGGGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTCGTC
TCCATGCTATCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACAAGG
ATATTCGATGTTTTTCTGAATGGAAAAGTAAGCCACATTGGGTACTCATTGAAGCGCTTG
TGCAAGGCCGCACGCTTCATCGCGTTGCCCCATAACCATAAGAAGGTTGGGTTCAGGGGT
GCTGTTCGAGTGCTTGTCTTCACCATCGTCTTGTGTCCGCTGTTCCTGCTCTACATGTTT
GGGCTCTTCGTTTCCCCCTGGATTTCGCTGTGGCGTCTAATCCAGCAGGATTACGGCGTG
ACGGCCGGAGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTTCTCTACTCC
CTGGCCCTGTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGGGAAGAACAG
AAGCTAGTGAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGCAGTTCAGTT
TCGGACTATTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTTGCCAGAGGG
AGGAACCTGATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGATGGGTACCTT
TCAGGTGCACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCATCGGGGAGC
GAATTACCGGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCCTCCAGTCCC
ATACTCCACAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGAGAGATCAGG
TTGCGAGCCGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGACAAAATCCTG
CAGGGGATTCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTTCAGAATGAC
CACCATAGTTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAAGAGGATGAT
CACCAGATTTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAGATGCAACTT
ACAGGCATGCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTCCTCATGAGC
AACACAGATGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCCAAGGGATCA
CTTCACAAAAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTGAAGATACTA
AGCCGATTTATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTGTGGCATGAA
ATATCAACAAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGTGACCAATGT
GACTCTGTGCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATGGATACATCT
TCGGCTATGGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGACATGTCTCTT
CACAACAGTAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTCAAGAAACAA
GGGTTAAGCATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGCGAAGGAGAC
AGAGAAAGGTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAGGGCGACTTT
GGAAATCTGCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATTCTCAAAGAA
ATATGCATGGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTCATCGGCACC
CTGATGGACATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTAGCAGGTGAT
GATCTGGTGCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTGAGGAAATAT
GGTCATGATATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGCAGCATGCAC
AGAAAAATTGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACTGACGAGGAA
CATCTTCAGAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTAAGAGAAGCA
CTTGGTTGGGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGCCTTGAAGGT
ACCCAAGATGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCAACCGTGTTT
AACAGAATTGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATCGCCGCTGGT
ATCTGCGACCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAATGAAGCTGTA
AAAGTTCATCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCCAGGCCGGAA
CTGTACGAGTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTGGGCGAGGAA
GATCCCAACGCGTGTTGTATCTCTTGA

Protein

869 aa

>Os12t0285100-02 Atypical resistance protein with Armadillo repeats
MSGAGQSRGHRLGLHIDSDWPEVLLINDYAVFMGYLSMVVTGTGFLVLTWSTVILLGGFV
SMLSNKDFWSLTVITLVQTRIFDVFLNGKVSHIGYSLKRLCKAARFIALPHNHKKVGFRG
AVRVLVFTIVLCPLFLLYMFGLFVSPWISLWRLIQQDYGVTAGDSSSKAHLQPALVVLYS
LALFQGVLFYYRAISAWEEQKLVKDVADKYMFDTVSRSSVSDYLHEIKVGCENDPSFARG
RNLITYAVKLMESTSPDGYLSGARILDTLIKFNRDDASGSELPGQSMQIYNMIGSASSSP
ILHNLVQMLDFKSAYDGEIRLRAARIVEHFAGEVRLDKILQGIRCVSSLLELEQKGFQND
HHSSFQEDDGDQLSFEEEDDHQISVKEKDYYPKDYKQMQLTGMQILLKLSYDKNNLFLMS
NTDDPALINKIVALITSKGSLHKKQHNEWSCMAELGVKILSRFMRFMYGPTKSNNILWHE
ISTSSKAIGTLESILECDQCDSVLKKHAIRILKRIFMDTSSAMGEGDRERFIGSLMDMSL
HNSNGDFQNLAGVDLALKKQGLSILKEIYLNPSSIMGEGDRERFIGSLMDMFLDNSKGDF
GNLPGEDLDLKKQELSILKEICMDPSSFMGEGDREKFIGTLMDMFLHNSKGDLFEKLAGD
DLVQICRRSGSSATIILRKYGHDIVDCIADTRSSVYSSMHRKIAAKILNHLCSPYSTDEE
HLQNLKEAIIDLIPKVLREALGWGLTGEEILRVAVSGLEGTQDDDWKLQEALASLCATVF
NRIVSKDADLTARFNNIAAGICDQTTKPRMTFADLINEAVKVHRIEFKKPEKPKPAARPE
LYEFVTAKYTPPHFMFLGEEDPNACCIS*

5'UTR

chr12:10822540..10823043 (+ strand) : 504 bp

chr12:10823342..10823586 (+ strand) : 245 bp

chr12:10824065..10824086 (+ strand) : 22 bp

CDS

chr12:10824087..10824325 (+ strand) : 239 bp

chr12:10830812..10832777 (+ strand) : 1966 bp

chr12:10833093..10833494 (+ strand) : 402 bp

3'UTR

chr12:10833495..10833577 (+ strand) : 83 bp

FASTA

>Os12t0285100-02 class=Sequence position=chr12:10822540..10833577 (+ strand)
ACTGCTTTCC CTCCTCCTCA TCCTCATCTT CATCTCTAGA CCTCATCTTC TCCAGCCACC ACCGCCTCCC TTCCCACCGG
TGGTGGCAGC GGGAAGACAG CGGCTCGGTT GAGCCCGGCG GGGAGGGCAC GATTTGGTAT GGGAGGAGCA GCGGCGACTC
CATCCGGCGG TGGATCCGCC GCCTCCTAGT CCCAGCTCTC TCTCCCCCGA TCCTCCTCCT CCCCTTCCTC CACCGCCACC
ACCCACCCCT CTCCCTCTCT CAGATCTGGT GCGCGGGGAG CGGTGGAGGC TACGGCGGCG GCGGCGGCGA GATCGGTAGC
AGTGATGGTG GAGAGGACGG ATCCGATGGC GGTGGTTCTC GTCAACCAGT TCAAGGACGA CGACAGCAGC GGCTGCTGCA
ACGATGGATA GGCTCTGGGC GGCTCCTCCA CTCTCCTCCC CTCTCTCATA TCCAGTGGCT CGGGGTGGTG GGGCGTGGCC
GACGCATCCG GCGGCGGAGC TCGGGTATCG ATCCGGCATG TTTTTTTTTC TCCAAAATCA ATTTTTCTTG GTGGTCGGGA
AACGGATTTT CAATTTTCTT TTTTTCGCTC GAATATCTTT TTCGCTGGCG GTCAACGTAA CTTAACCGCT TGTGAAAACA
AGCTTTAAAG TTTcgctagt gaagattgtt attttcactt gccatttgtt tgcgggcggc tgacagtgcc accagcgaaa
aACTCTTTTG CTAGTAGTGA TTGCTAGATG GTCAGCAGAG AACTTGTGGA GCATATGACT ATCAACTAAC AGTACACTTC
AGCAGAAAGA GGATGGTTCT AGCTCTCCGA TGGTTTAATA TTGAAACGTA CAGCCCACCC ACCACCACCC CAGTCGTCCC
CAGCTAAGCG CTCCCTTGCT TGCCTCAGTA GACGAGCTGC CAACTAGTAG CACTCCAGCA AGCAGCGGGT CAGCGGAGTC
CGGAGGGCGC ACGTGCGCCG CAGCGAGGTA TCAGCATGGC CAGGCGGCGG CTGGCTGGCC GGCCGGGTTC GGCAAGCGGC
TAAGCAGGTA ATTAAGGGAC TGCAGATACT GCTTGTGATC ATCCCTTAAA ATTTCGTCTT TCTTGTCTTG ggccaggttt
aattcctaat tttttcttca aactttcaac ttttccatca catcaaaact tttctacaca cacaaacttt caacttaatt
ttccgtcaca tcgttccaat ttcaatcaaa cttctaattt tagcgtgaac taaacacacc ctTGGTTGTG ACTCTGGGAG
TCGATACATA GGCCTTAATG CTCGTAGTTT GTGGATTTTG GGGTTAAACT GGCGTGGAAC TTTACTTGGA TACCACCTGG
GAGTTGATGT GATTTTAGTG TTTAGTACAG TTTAGAGTTT ATTACCTACC GGTTTCTTGG TGCCTGGCGC ACACTGAGCA
TGCAAATGCA GTGAGAGCCA GTATCATCTA AGACGGCTGG ACCTGAAATA TTTTACCATG TATATATCAA ACTCGACTTG
ATCAGGTGTT TAGCGGAGGA AGGATCGATG TCCGGCGCCG GACAGAGCCG TGGTCATCGC CTTGGATTAC ACATTGATTC
GGATTGGCCA GAGGTCTTGT TGATCAATGA CTATGCGGTG TTCATGGGGT ACCTGTCGAT GGTTGTCACC GGGACGGGGT
TCCTGGTGCT CACGTGGTCC ACCGTCATCC TCCTCGGTGG ATTCGTCTCC ATGCTATCCA ACAAGGACTT CTGGAGTCTC
ACGGTGATCA CGCTCGTTCA AACAAGGTGA GCTATCTATA GCCATCTCCA CCAGACTTAT ATTTATTTCG CGTTCCCAAC
ATTAACCAGT TCAGCCAAGC ATTTGGAGTT TCGCATTGCT AGCTAGCTAC TAGTTTACTG TCAGATCTAG TGTTGCGAAC
CGAATATGCT GCAAAACGTT GCAATTCCAG AGTGGCTTTA TATACTACAT TGATATGAAA ATATTCAAGT CCCATATTTG
caaaatcaac tatttttaaa atcgaattat tttctcccct tttcaagaag catgtatttt gtatatttct ctccccattt
gataataatt tcatcaagaa ttttaaaaga gaatataacc aataaagcac aaatgtcatg atttcatgat tgtgacatgt
aataatcact tcttttttaa tttttatttt aattttctga aatttttttg agagctttga agtgtaccta aagcaatgca
attcatggtc atatgttgca agacaaatga gataaattca tcaactagtt aacaagcatg cattagagta taaacatgaa
tcaaaggtat tacaattaag ctcaaatctc tactattata aaaattgaag atgtttttgc cggtggcttg gtaagtcgtc
atgtccgaat TAGCCTCGCA CATAATTACT GCCAATTTAA TTATTTATGT GCCCCACATG TATGAGCTTT AAACATTAGA
TTTTCCATAA GAAAATTTGC TTGTTCGGAT CAGTGCCTTT GGCCGATTGC GTTTCATCCT GTGCATTGTC ACGAACCAAC
CACCACCGCG AGGTTGTCAT CTTGCTGATA CGGTCTGTTC GGCAACACGG TTTGGGACCT GCTGTCGTGC ACCTATATCA
ACACCAACCA GCAGCAGTCA GGTGTGTTGC CGTGCGCCGA GGCAAGCAGC ACGACGTACC ATTGTTGATT ATTCTCTACA
CGCACACACC GTATCGAGAA GAATTCCTAC TGTGTTCATC AGAAACTCAA TCCAATATTG TCTACTGTGT ATACGTGTTC
CAAAAAGATT AAAGAAAAGA TCAGGATCGA TATCAAAGCC GAGATCTATT ACTACCCACA TATCGAAAAT CCACGCGTGC
AGCAAGACGA TCAGCAACAG CAGCCGATCG ATGACGGTTG CCAAGAGAAA TACGAAAACC TAATCAGAGA AATATTCAAT
CAAGCTACTG CGCACATATA TCTTTACCTC TTAAATTATA TTTCTATctc tactattata aaaattgtag atgttttcgt
cagtatttta gtacgtcatc cgcgtatgag tcggttttta agtccgtttg attttggaaa tacaaatccg tatttgagtc
agtttttaag ttcgttcgct tttggaaata cagaagaaat cgtataagaa atctctttaa aaactcacat actactaact
tgagacgttc ggacacctaa ttacagctca tgattttcta acacaatata tatccaagcg aatttgacac agtgaatttc
atcttaactc gatataatat aataagatta aaataatctt cacccgttgc aacacacggg cattttttct agtcaataat
aaagataatg atttcaaacg atttataatg caacatattc acaagtacat aggttgaaaa aaaatcccta tatatatata
tatacctatt gcatcatcac tctttctcaa aataacttct tcacaaaaat aaccaagaga attttcaaca agtattagag
ctttttgtgc tcattttgac attgataata aaatatctca atttatttcg agtacgtccg tgtcgttaag aatgttctaa
ggatttggta cccattattt tccttactgt aaatacggct ttatcgtcaa tactgtttcc aaggattctg tattcatttt
ttttctctca tcataagcaa ctttttattc tcctgtgaca tttggaataa acaataagca atttgaggaa taacaatcca
ataagtataa atataagcat taatcatcca aactcagcac ttgctttaac attgcatatt tacttaaatc aagtaaaaga
attagtgtca tgcatcatct cacttaaaag taatatccaa gccacatgaa aagactaaaa tgcatacaag ctaacatatc
aacaaatata catcaattat tttactagca tgcacaagaa tatactagag gtatatacca aagctcttct ttttctcatt
ttttttcttt attttcagat ttagagcaat gcatggatat agacatgaat gcaccgaaaa agcacaaact tcccctcaaa
taaacctcca attctccctg aagaaaaatc aagaagaaat caaagatttt gaaaaagaca tctaattgcc aatgatatca
ccaaggttct tatgaattaa catatatcca tttgaattac caaaactacc tcttcaaaca ctagcatgaa aagcttataa
acgaagaagt agaacaaagt tatgtcaact caaaagtaca ttgatgttac cttgaaaaga aatcaccgtc tccgcactaa
acaatcatgg ggagtatgcc gccaaaatac ctatgaacat gaagatgttg aggcctccgt gttggcatta gtcataaaaa
aatttggaat ccaacactga accagtaggt acatatgcac gaacaaaatc ggaaccaaac atacctgaaa acttaccttg
acgcttcaca aaaatccgat ttgaattacg cgcaaaatcg ccccgaggtc ggtctgatcg cagttgtacc tgcagtctgc
ccgggcctag tcgccggtct gaccattgat atacctgcag tctgaccgcc attggcaact agtatgaccg attggttagt
gtcggtctaa ccaagctcct taatccacaa ccttgttttt gccactgtcg tttcgcaaaa gcaatttctc tttccttttt
ctgtttgcgg acaagtctaa aacaaaaacc aaccaaatat tcatcttttc caaaaaaaga acaagtgtat ctctcacgac
aagaaatttt tgaagtagat ggttttgcaa tgaaagtctt tttctcttga gtcgtcgaag aaagagacgg caaaactcct
taggtttggg ttttgtactt cacctttttc agttatgctc aagacaacat atcggtgatt tgtaaaatgg gcattggtat
caaaacctac accacaatta taagcactca cttttgactt atccaaatca tgttaagttt cttcttacca tcagaaaacc
tttccaaata agaaacttct tttgtcaaat tttcacaatt ttcatcatca accaaaacac cattgttctt tgtgacaatt
agaacaagaa agcacctcat cagcttttac aagatcctcc atatactcaa cacgccctaa agcatctttc aatctcattt
cattcaaaaa acactttgag caatttggag aaaccaaaac atatttgtgt tgtttaatcc tttatgcact caaaacattg
aacaaagaac acgcacaaaa agcaacttta tatttttttt caaaacgttc ttttgtcaaa gtcaactcat taacaacatg
agagcatgca aagcaaatcc aagagaaaaa gacaaataaa gcttgttagt tttttcaacc tcagattcca atctaaagca
attaacataa ttggcatctc ataaagcagt aatttcagat aataaagctt cccaagattt gcaatcatca tcattaggaa
ccatagattt taatctaaca atttcagcat ttaaaattca atagtgtggt tactctcatt aagcaaatta gaacatgttt
tcaatttctc agcaaatttt aaagcaatat gttcttattg atcttaacta agcttttttt cactatcaga ttcattaaca
tcagagtcta cattgcgagc agtaaaagcc aaatcaacaa cttaatcaac aacttgctta cctttgctat ggcgctcatc
ttcatcctct gattcttcac tatcaaaagc ttctatcaat tcttgaattA GCCTTTGCTT GCGAATCTTC TTGCTCTCCT
TCTTCTTGTC ATTCTTGTTC ACTTTCTCCT CCAAGCTTGT CTTCTTGCGG TTAGGACAAT TGAACTTGAT GTGATTTAAC
TTGCCACACT GAAAGCATTG AACAGATCCT CCTCGCTTCC TATTCTTGAC TTTTTCAAAA CCCTGAGAAA GTTTGTTAGT
AACCTAAACC AAGTCCTCCT CGAATCACTC GAGTTGTTTA TCGGACATGG CTTTAATAAA ATTAAGAGCT GATGAAGAAG
AAGCACCAAT GGAAGAACTC AAAGAAGAGA TCAAGGCACT AATTTAAGGA TCAATCTTGC GGGAAAGAAT ATTCACCTCA
TGAGTTTTAA GCTTGGTGTA AAGAGAATCC AAAGTCAAAG CGGACATGTT AACAGATTCC TAAATTGAAG TCACTTTCAT
CTCCCAGATC GACATATCAA GACCATTCAA AAAGTGTCGA GAAATCTCAG ATTGTGTGTA ATAAGTATCA TAAGAGGAAT
CAACAGATCT AAGATTACTC AAAACTTTGT TAAAGCGTGC AAGATAATCA TCCAAAGTCT CTTCAGGTTG CATCTCAAAT
TTTACGTAAT CCTTTTAAAA AGATCTTTGC GCACTTCATT GATATTAGAA GTCCCTTGGT GAAAATCAGA TAATGGCTTC
CAAATCTCAT GCGCGGTTTG CAGATGAGAA ACACGATCAA AATCCGAACA AGGAATTCCA TTAAGCAAAA TATTGCGAGC
TTTGCAATTG TTTTTAAAAT CAGTCTTAAG AACAACAGTA TTAATCTAAG CAGGAATTTT ATAAGGATTT GCAACTTTTT
GCCAAATATC ATAACTCTCA GACATAATAT AAGATTTCTT TTCGCACCAA TAAGGAAAAT TGACTCCATA AAAAACATGT
GGCCAGGTCA TAAACTTGTT AGCCATGGCA AGAACTCAAG ATCGGCAAAG ATCAAATAGA GTGAACATGG CTCTGATACC
ACTTGTAAGA TCGAAAAAAA AGAACCAAGC CAATCAGAGA GGGGTGAATG GTTGTAACAC CAAAAATCAA AAACTTTTAG
CGGACATAGA AGTTACCCTT GTTGATGAAG TCAGTGCAAC GCGGTCTGAC CACCATGTGC GCACCGATCT GACCGCTCCT
ATGCCGCTGG TCTGACAGGT GTTGTCTGGC CGATAAGACC ACCGCCTCTC TACTTGTCAC TGCTCGCCGC CGCCAGTCTG
ACTGCTTGAT TGCCGCTGGT GACCGCTCGT AATACTTCGG TCAAACCATC GACCGTCGAG ATCCAGAAAA CACCGATAGA
TGAAAACTCT AAGATGTAGA TTAATCTATC TCGACTTTAT TGCATCAACT AGTGTTTACA AAGTGCACCA ACATCACTCC
TCACCAAAAT CTCGAACTAG ACTTGATACC CAAACTTATC TCTCAACTCA ACTCTCTATC CATTGATACC GGCAGACAAC
ATCCTCCCTC TCTATTTATA CCGATAACAT GGCTGTCCCT AGCCACGAAT CCAACTCATA CAAAAAGTCC TTCCCGTATA
AGAAACAAAC TTTACAAACT CTAGTCTTTC CAAACTTGGA CTCCGATCGA AATTTGACTC CTCTTTCCAT ATGCACACAA
CACGATGTGT ATGCCATATG GAAACCTTCA CCTCCATGTA CATTGTTCTC TAGCTTGAGC ATCCCGCATG ACATCCTTGA
CCGTCTGGAC CTCAACTTCT TCCGAGCCTA GTCCTGATCC ATCACCGACT ATACTCCCAT AGCCTCAAGC AACACCTGCA
CATGAATAAC AATGAAACTC CATATCTGAG TACAAGTTCA CGCTAACTTG ACTCACATCA GCATACAATA GTATCACATA
CGAATAGAAA CCATCTAGAA ATAATAAACA TGAATCAATC TAGAAATTCC ATAAAAACAA CCCGAAACCG ACTCCCTCTT
GGAATCACTC AGTCAGACCA TCGGGCCGCC CGGTCTGACC GGTGCCTCCT GCCCGGTCTG ACAAGCACCC GGTGCCGACC
GCAGTGTTCA CCATTcgaaa atactatcca ccgtattttc aacaacactt accgttgaca attgttcatc accaagatta
atcatcatat gattctacaa cagacagaca cataggcatg ttcagagaga tgccatacta GAATTGAAAT GTCAAATTTT
GGAAGAGAAA AAAAAATAGT TAATAAAAAA GAAAAAGAAA GAGCTACTCT CTGCATTCAT TCTTTCATGG CAAAATTAAT
TTTACACGAT CGCCAAAAGT AAATTTGATC ATTAATTAAT GTGAAATTAG TTTGACAGGA TGGCATGTAC TGAATCTTAT
TTTATTATTG TGTTCATCCC TAACAAAAAA ACCGTACTTA CTCTTTCCAC TGTCGGTATC TGTCCTTTTA ACCGGAAAAT
TCATCCATCC AAACAAAAAA TATCTGAAAC AGGATATTCG ATGTTTTTCT GAATGGAAAA GTAAGCCACA TTGGGTACTC
ATTGAAGCGC TTGTGCAAGG CCGCACGCTT CATCGCGTTG CCCCATAACC ATAAGAAGGT TGGGTTCAGG GGTGCTGTTC
GAGTGCTTGT CTTCACCATC GTCTTGTGTC CGCTGTTCCT GCTCTACATG TTTGGGCTCT TCGTTTCCCC CTGGATTTCG
CTGTGGCGTC TAATCCAGCA GGATTACGGC GTGACGGCCG GAGACAGCAG CAGCAAGGCA CACCTGCAGC CTGCGCTGGT
GGTTCTCTAC TCCCTGGCCC TGTTCCAGGG CGTCCTCTTC TACTACAGGG CCATCTCTGC TTGGGAAGAA CAGAAGCTAG
TGAAAGATGT GGCCGACAAA TACATGTTTG ATACAGTGTC GCGCAGTTCA GTTTCGGACT ATTTACATGA GATCAAGGTC
GGATGTGAGA ATGACCCGTC CTTTGCCAGA GGGAGGAACC TGATCACATA CGCTGTCAAG CTGATGGAAT CCACATCACC
GGATGGGTAC CTTTCAGGTG CACGGATTCT TGATACACTC ATCAAGTTTA ATAGAGATGA TGCATCGGGG AGCGAATTAC
CGGGGCAGAG TATGCAGATA TACAATATGA TTGGATCTGC ATCCTCCAGT CCCATACTCC ACAACTTAGT TCAGATGCTG
GATTTCAAAA GTGCATATGA TGGAGAGATC AGGTTGCGAG CCGCAAGGAT TGTTGAGCAC TTTGCTGGTG AGGTCCGTTT
AGACAAAATC CTGCAGGGGA TTCGATGTGT ATCTTCCTTG CTTGAACTCG AGCAGAAAGG ATTTCAGAAT GACCACCATA
GTTCTTTCCA AGAAGACGAC GGCGACCAAC TTTCTTTTGA AGAAGAGGAT GATCACCAGA TTTCTGTCAA AGAAAAGGAT
TATTACCCCA AAGATTATAA ACAGATGCAA CTTACAGGCA TGCAGATCCT TTTAAAGCTC TCCTACGACA AGAACAACTT
GTTCCTCATG AGCAACACAG ATGATCCGGC CTTGATCAAC AAGATTGTGG CACTTATAAC GTCCAAGGGA TCACTTCACA
AAAAACAACA TAACGAATGG TCCTGTATGG CAGAGCTCGG GGTGAAGATA CTAAGCCGAT TTATGCGATT TATGTATGGC
CCTACAAAAT CAAACAATAT TCTGTGGCAT GAAATATCAA CAAGCAGCAA AGCAATCGGC ACCTTGGAGA GTATTCTTGA
GTGTGACCAA TGTGACTCTG TGCTGAAGAA ACACGCCATA AGGATTCTCA AAAGGATATT CATGGATACA TCTTCGGCTA
TGGGTGAAGG AGACAGAGAA AGGTTCATTG GCTCCTTGAT GGACATGTCT CTTCACAACA GTAATGGTGA CTTTCAAAAT
CTGGCAGGTG TAGATCTGGC GCTCAAGAAA CAAGGGTTAA GCATTCTCAA AGAAATATAC TTGAATCCAT CTTCGATTAT
GGGCGAAGGA GACAGAGAAA GGTTCATCGG CTCCCTGATG GACATGTTTC TTGACAACAG TAAGGGCGAC TTTGGAAATC
TGCCAGGTGA AGATCTGGAC CTCAAGAAAC AAGAGTTAAG TATTCTCAAA GAAATATGCA TGGATCCATC TTCGTTTATG
GGCGAAGGTG ACAGAGAAAA ATTCATCGGC ACCCTGATGG ACATGTTTCT TCACAACAGC AAGGGCGACT TGTTTGAAAA
ACTAGCAGGT GATGATCTGG TGCAGATATG TAGAAGAAGT GGAAGCAGTG CCACGATCAT ATTGAGGAAA TATGGTCATG
ATATTGTTGA TTGTATTGCT GATACTCGTT CAAGCGTATA TAGCAGCATG CACAGAAAAA TTGCAGCAAA GATCCTCAAT
CATCTGTGTA GTCCCTACTC CACTGACGAG GAACATCTTC AGAATCTGAA GGAGGCCATC ATTGATTTGA TACCCAAGGT
ACGTTAGTCG CTGTCATTTA TACTTCTTAT GTCAACAAAC ATTTTTTTTC ATGATAATGA AATATAACTC TGGCAGCCTC
TACATTGTCA GATGCACGAA ACCATAGCTC ATTAAATAGT TTGGCAACCT CTACATTCGC AGCAATCCAT GGGTAACAAA
CTTGTTTAAA GCAAAACTGA AGCACAACTT GTATCATTAA AATTTCATCC ATGCTTACTG AATATCCATC AGAGTAGTCT
CCAAAAGATG GGATACTGCT TTTATATGCA TCCTATTTAT ATCGGAATGA CCGAAAGCAC TGTAATGTTG CAGGTGCTAA
GAGAAGCACT TGGTTGGGGG TTGACAGGAG AAGAGATACT GCGAGTGGCA GTTTCAGGCC TTGAAGGTAC CCAAGATGAT
GACTGGAAAT TGCAGGAAGC ATTGGCGTCC CTCTGTGCAA CCGTGTTTAA CAGAATTGTC AGCAAGGATG CAGATTTGAC
TGCTCGGTTC AACAACATCG CCGCTGGTAT CTGCGACCAG ACAACGAAGC CTCGCATGAC CTTCGCAGAC CTCATCAATG
AAGCTGTAAA AGTTCATCGC ATCGAATTTA AAAAACCAGA AAAACCAAAA CCAGCTGCCA GGCCGGAACT GTACGAGTTT
GTGACTGCGA AATACACCCC GCCCCACTTT ATGTTTTTGG GCGAGGAAGA TCCCAACGCG TGTTGTATCT CTTGATAACA
CCCTAATTTG tactttctcc gtttcacaat gtaagtcatt ctattatttc ctatatttat atggatatta atgaatct