Os12t0285100-03

Locus

Os12g0285100

Description

Atypical resistance protein with Armadillo repeats

RAP-DB Gene Symbol Synonym(s)

Ptr

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

AK121318 (DDBJ, Best hit)

Protein Evidence

Q0INW2

Literature

PMID: 29795191

Note

Manual Curation

February 19, 2020

Functional domain (InterPro)

Armadillo-type fold (IPR016024)

Experimentally confirmed subcellular location

whole cell

Full-length cDNA

J023113P04 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0285100-03)

Transcript

3389 bp

>Os12t0285100-03 Atypical resistance protein with Armadillo repeats
CTTTCCCTCCTCCTCATCCTCATCTTCATCTCTAGACCTCATCTTCTCCAGCCACCACCG
CCTCCCTTCCCACCGGTGGTGGCAGCGGGAAGACAGCGGCTCGGTTGAGCCCGGCGGGGA
GGGCACGATTTGGTATGGGAGGAGCAGCGGCGACTCCATCCGGCGGTGGATCCGCCGCCT
CCTAGTCCCAGCTCTCTCTCCCCCGATCCTCCTCCTCCCCTTCCTCCACCGCCACCACCC
ACCCCTCTCCCTCTCTCAGATCTGGTGCGCGGGGAGCGGTGGAGGCTACGGCGGCGGCGG
CGGCGAGATCGGTAGCAGTGATGGTGGAGAGGACGGATCCGATGGCGGTGGTTCTCGTCA
ACCAGTTCAAGGACGACGACAGCAGCGGCTGCTGCAACGATGGATAGGCTCTGGGCGGCT
CCTCCACTCTCCTCCCCTCTCTCATATCCAGTGGCTCGGGGTGGTGGGGCGTGGCCGACG
CATCCGGCGGCGGAGCTCGGACGAGCTGCCAACTAGTAGCACTCCAGCAAGCAGCGGGTC
AGCGGAGTCCGGAGGGCGCACGTGCGCCGCAGCGAGGTATCAGCATGGCCAGGCGGCGGC
TGGCTGGCCGGCCGGGTTCGGCAAGCGGCTAAGCAGGTGTTTAGCGGAGGAAGGATCGAT
GTCCGGCGCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGATTGGCC
AGAGGTCTTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTTGTCAC
CGGGACGGGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTCGTCTC
CATGCTATCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACAAGGAT
ATTCGATGTTTTTCTGAATGGAAAAGTAAGCCACATTGGGTACTCATTGAAGCGCTTGTG
CAAGGCCGCACGCTTCATCGCGTTGCCCCATAACCATAAGAAGGTTGGGTTCAGGGGTGC
TGTTCGAGTGCTTGTCTTCACCATCGTCTTGTGTCCGCTGTTCCTGCTCTACATGTTTGG
GCTCTTCGTTTCCCCCTGGATTTCGCTGTGGCGTCTAATCCAGCAGGATTACGGCGTGAC
GGCCGGAGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTTCTCTACTCCCT
GGCCCTGTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGGGAAGAACAGAA
GCTAGTGAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGCAGTTCAGTTTC
GGACTATTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTTGCCAGAGGGAG
GAACCTGATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGATGGGTACCTTTC
AGGTGCACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCATCGGGGAGCGA
ATTACCGGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCCTCCAGTCCCAT
ACTCCACAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGAGAGATCAGGTT
GCGAGCCGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGACAAAATCCTGCA
GGGGATTCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTTCAGAATGACCA
CCATAGTTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAAGAGGATGATCA
CCAGATTTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAGATGCAACTTAC
AGGCATGCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTCCTCATGAGCAA
CACAGATGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCCAAGGGATCACT
TCACAAAAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTGAAGATACTAAG
CCGATTTATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTGTGGCATGAAAT
ATCAACAAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGTGACCAATGTGA
CTCTGTGCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATGGATACATCTTC
GGCTATGGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGACATGTCTCTTCA
CAACAGTAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTCAAGAAACAAGG
GTTAAGCATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGCGAAGGAGACAG
AGAAAGGTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAGGGCGACTTTGG
AAATCTGCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATTCTCAAAGAAAT
ATGCATGGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTCATCGGCACCCT
GATGGACATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTAGCAGGTGATGA
TCTGGTGCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTGAGGAAATATGG
TCATGATATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGCAGCATGCACAG
AAAAATTGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACTGACGAGGAACA
TCTTCAGAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTAAGAGAAGCACT
TGGTTGGGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGCCTTGAAGGTAC
CCAAGATGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCAACCGTGTTTAA
CAGAATTGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATCGCCGCTGGTAT
CTGCGACCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAATGAAGCTGTAAA
AGTTCATCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCCAGGCCGGAACT
GTACGAGTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTGGGCGAGGAAGA
TCCCAACGCGTGTTGTATCTCTTGATAACACCCTAATTTGtactttctccgtttcacaat
gtaagtcattctattatttcctatatttatatggatattaatgaatctatatatatatat
atatatatttgtctagatttattaacatc

CDS

2607 bp

>Os12t0285100-03 Atypical resistance protein with Armadillo repeats
ATGTCCGGCGCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGATTGG
CCAGAGGTCTTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTTGTC
ACCGGGACGGGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTCGTC
TCCATGCTATCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACAAGG
ATATTCGATGTTTTTCTGAATGGAAAAGTAAGCCACATTGGGTACTCATTGAAGCGCTTG
TGCAAGGCCGCACGCTTCATCGCGTTGCCCCATAACCATAAGAAGGTTGGGTTCAGGGGT
GCTGTTCGAGTGCTTGTCTTCACCATCGTCTTGTGTCCGCTGTTCCTGCTCTACATGTTT
GGGCTCTTCGTTTCCCCCTGGATTTCGCTGTGGCGTCTAATCCAGCAGGATTACGGCGTG
ACGGCCGGAGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTTCTCTACTCC
CTGGCCCTGTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGGGAAGAACAG
AAGCTAGTGAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGCAGTTCAGTT
TCGGACTATTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTTGCCAGAGGG
AGGAACCTGATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGATGGGTACCTT
TCAGGTGCACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCATCGGGGAGC
GAATTACCGGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCCTCCAGTCCC
ATACTCCACAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGAGAGATCAGG
TTGCGAGCCGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGACAAAATCCTG
CAGGGGATTCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTTCAGAATGAC
CACCATAGTTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAAGAGGATGAT
CACCAGATTTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAGATGCAACTT
ACAGGCATGCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTCCTCATGAGC
AACACAGATGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCCAAGGGATCA
CTTCACAAAAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTGAAGATACTA
AGCCGATTTATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTGTGGCATGAA
ATATCAACAAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGTGACCAATGT
GACTCTGTGCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATGGATACATCT
TCGGCTATGGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGACATGTCTCTT
CACAACAGTAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTCAAGAAACAA
GGGTTAAGCATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGCGAAGGAGAC
AGAGAAAGGTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAGGGCGACTTT
GGAAATCTGCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATTCTCAAAGAA
ATATGCATGGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTCATCGGCACC
CTGATGGACATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTAGCAGGTGAT
GATCTGGTGCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTGAGGAAATAT
GGTCATGATATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGCAGCATGCAC
AGAAAAATTGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACTGACGAGGAA
CATCTTCAGAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTAAGAGAAGCA
CTTGGTTGGGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGCCTTGAAGGT
ACCCAAGATGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCAACCGTGTTT
AACAGAATTGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATCGCCGCTGGT
ATCTGCGACCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAATGAAGCTGTA
AAAGTTCATCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCCAGGCCGGAA
CTGTACGAGTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTGGGCGAGGAA
GATCCCAACGCGTGTTGTATCTCTTGA

Protein

869 aa

>Os12t0285100-03 Atypical resistance protein with Armadillo repeats
MSGAGQSRGHRLGLHIDSDWPEVLLINDYAVFMGYLSMVVTGTGFLVLTWSTVILLGGFV
SMLSNKDFWSLTVITLVQTRIFDVFLNGKVSHIGYSLKRLCKAARFIALPHNHKKVGFRG
AVRVLVFTIVLCPLFLLYMFGLFVSPWISLWRLIQQDYGVTAGDSSSKAHLQPALVVLYS
LALFQGVLFYYRAISAWEEQKLVKDVADKYMFDTVSRSSVSDYLHEIKVGCENDPSFARG
RNLITYAVKLMESTSPDGYLSGARILDTLIKFNRDDASGSELPGQSMQIYNMIGSASSSP
ILHNLVQMLDFKSAYDGEIRLRAARIVEHFAGEVRLDKILQGIRCVSSLLELEQKGFQND
HHSSFQEDDGDQLSFEEEDDHQISVKEKDYYPKDYKQMQLTGMQILLKLSYDKNNLFLMS
NTDDPALINKIVALITSKGSLHKKQHNEWSCMAELGVKILSRFMRFMYGPTKSNNILWHE
ISTSSKAIGTLESILECDQCDSVLKKHAIRILKRIFMDTSSAMGEGDRERFIGSLMDMSL
HNSNGDFQNLAGVDLALKKQGLSILKEIYLNPSSIMGEGDRERFIGSLMDMFLDNSKGDF
GNLPGEDLDLKKQELSILKEICMDPSSFMGEGDREKFIGTLMDMFLHNSKGDLFEKLAGD
DLVQICRRSGSSATIILRKYGHDIVDCIADTRSSVYSSMHRKIAAKILNHLCSPYSTDEE
HLQNLKEAIIDLIPKVLREALGWGLTGEEILRVAVSGLEGTQDDDWKLQEALASLCATVF
NRIVSKDADLTARFNNIAAGICDQTTKPRMTFADLINEAVKVHRIEFKKPEKPKPAARPE
LYEFVTAKYTPPHFMFLGEEDPNACCIS*

5'UTR

chr12:10822544..10823043 (+ strand) : 500 bp

chr12:10823451..10823586 (+ strand) : 136 bp

chr12:10824065..10824086 (+ strand) : 22 bp

CDS

chr12:10824087..10824325 (+ strand) : 239 bp

chr12:10830812..10832777 (+ strand) : 1966 bp

chr12:10833093..10833494 (+ strand) : 402 bp

3'UTR

chr12:10833495..10833618 (+ strand) : 124 bp

FASTA

>Os12t0285100-03 class=Sequence position=chr12:10822544..10833618 (+ strand)
CTTTCCCTCC TCCTCATCCT CATCTTCATC TCTAGACCTC ATCTTCTCCA GCCACCACCG CCTCCCTTCC CACCGGTGGT
GGCAGCGGGA AGACAGCGGC TCGGTTGAGC CCGGCGGGGA GGGCACGATT TGGTATGGGA GGAGCAGCGG CGACTCCATC
CGGCGGTGGA TCCGCCGCCT CCTAGTCCCA GCTCTCTCTC CCCCGATCCT CCTCCTCCCC TTCCTCCACC GCCACCACCC
ACCCCTCTCC CTCTCTCAGA TCTGGTGCGC GGGGAGCGGT GGAGGCTACG GCGGCGGCGG CGGCGAGATC GGTAGCAGTG
ATGGTGGAGA GGACGGATCC GATGGCGGTG GTTCTCGTCA ACCAGTTCAA GGACGACGAC AGCAGCGGCT GCTGCAACGA
TGGATAGGCT CTGGGCGGCT CCTCCACTCT CCTCCCCTCT CTCATATCCA GTGGCTCGGG GTGGTGGGGC GTGGCCGACG
CATCCGGCGG CGGAGCTCGG GTATCGATCC GGCATGTTTT TTTTTCTCCA AAATCAATTT TTCTTGGTGG TCGGGAAACG
GATTTTCAAT TTTCTTTTTT TCGCTCGAAT ATCTTTTTCG CTGGCGGTCA ACGTAACTTA ACCGCTTGTG AAAACAAGCT
TTAAAGTTTc gctagtgaag attgttattt tcacttgcca tttgtttgcg ggcggctgac agtgccacca gcgaaaaACT
CTTTTGCTAG TAGTGATTGC TAGATGGTCA GCAGAGAACT TGTGGAGCAT ATGACTATCA ACTAACAGTA CACTTCAGCA
GAAAGAGGAT GGTTCTAGCT CTCCGATGGT TTAATATTGA AACGTACAGC CCACCCACCA CCACCCCAGT CGTCCCCAGC
TAAGCGCTCC CTTGCTTGCC TCAGTAGACG AGCTGCCAAC TAGTAGCACT CCAGCAAGCA GCGGGTCAGC GGAGTCCGGA
GGGCGCACGT GCGCCGCAGC GAGGTATCAG CATGGCCAGG CGGCGGCTGG CTGGCCGGCC GGGTTCGGCA AGCGGCTAAG
CAGGTAATTA AGGGACTGCA GATACTGCTT GTGATCATCC CTTAAAATTT CGTCTTTCTT GTCTTGggcc aggtttaatt
cctaattttt tcttcaaact ttcaactttt ccatcacatc aaaacttttc tacacacaca aactttcaac ttaattttcc
gtcacatcgt tccaatttca atcaaacttc taattttagc gtgaactaaa cacaccctTG GTTGTGACTC TGGGAGTCGA
TACATAGGCC TTAATGCTCG TAGTTTGTGG ATTTTGGGGT TAAACTGGCG TGGAACTTTA CTTGGATACC ACCTGGGAGT
TGATGTGATT TTAGTGTTTA GTACAGTTTA GAGTTTATTA CCTACCGGTT TCTTGGTGCC TGGCGCACAC TGAGCATGCA
AATGCAGTGA GAGCCAGTAT CATCTAAGAC GGCTGGACCT GAAATATTTT ACCATGTATA TATCAAACTC GACTTGATCA
GGTGTTTAGC GGAGGAAGGA TCGATGTCCG GCGCCGGACA GAGCCGTGGT CATCGCCTTG GATTACACAT TGATTCGGAT
TGGCCAGAGG TCTTGTTGAT CAATGACTAT GCGGTGTTCA TGGGGTACCT GTCGATGGTT GTCACCGGGA CGGGGTTCCT
GGTGCTCACG TGGTCCACCG TCATCCTCCT CGGTGGATTC GTCTCCATGC TATCCAACAA GGACTTCTGG AGTCTCACGG
TGATCACGCT CGTTCAAACA AGGTGAGCTA TCTATAGCCA TCTCCACCAG ACTTATATTT ATTTCGCGTT CCCAACATTA
ACCAGTTCAG CCAAGCATTT GGAGTTTCGC ATTGCTAGCT AGCTACTAGT TTACTGTCAG ATCTAGTGTT GCGAACCGAA
TATGCTGCAA AACGTTGCAA TTCCAGAGTG GCTTTATATA CTACATTGAT ATGAAAATAT TCAAGTCCCA TATTTGcaaa
atcaactatt tttaaaatcg aattattttc tccccttttc aagaagcatg tattttgtat atttctctcc ccatttgata
ataatttcat caagaatttt aaaagagaat ataaccaata aagcacaaat gtcatgattt catgattgtg acatgtaata
atcacttctt ttttaatttt tattttaatt ttctgaaatt tttttgagag ctttgaagtg tacctaaagc aatgcaattc
atggtcatat gttgcaagac aaatgagata aattcatcaa ctagttaaca agcatgcatt agagtataaa catgaatcaa
aggtattaca attaagctca aatctctact attataaaaa ttgaagatgt ttttgccggt ggcttggtaa gtcgtcatgt
ccgaatTAGC CTCGCACATA ATTACTGCCA ATTTAATTAT TTATGTGCCC CACATGTATG AGCTTTAAAC ATTAGATTTT
CCATAAGAAA ATTTGCTTGT TCGGATCAGT GCCTTTGGCC GATTGCGTTT CATCCTGTGC ATTGTCACGA ACCAACCACC
ACCGCGAGGT TGTCATCTTG CTGATACGGT CTGTTCGGCA ACACGGTTTG GGACCTGCTG TCGTGCACCT ATATCAACAC
CAACCAGCAG CAGTCAGGTG TGTTGCCGTG CGCCGAGGCA AGCAGCACGA CGTACCATTG TTGATTATTC TCTACACGCA
CACACCGTAT CGAGAAGAAT TCCTACTGTG TTCATCAGAA ACTCAATCCA ATATTGTCTA CTGTGTATAC GTGTTCCAAA
AAGATTAAAG AAAAGATCAG GATCGATATC AAAGCCGAGA TCTATTACTA CCCACATATC GAAAATCCAC GCGTGCAGCA
AGACGATCAG CAACAGCAGC CGATCGATGA CGGTTGCCAA GAGAAATACG AAAACCTAAT CAGAGAAATA TTCAATCAAG
CTACTGCGCA CATATATCTT TACCTCTTAA ATTATATTTC TATctctact attataaaaa ttgtagatgt tttcgtcagt
attttagtac gtcatccgcg tatgagtcgg tttttaagtc cgtttgattt tggaaataca aatccgtatt tgagtcagtt
tttaagttcg ttcgcttttg gaaatacaga agaaatcgta taagaaatct ctttaaaaac tcacatacta ctaacttgag
acgttcggac acctaattac agctcatgat tttctaacac aatatatatc caagcgaatt tgacacagtg aatttcatct
taactcgata taatataata agattaaaat aatcttcacc cgttgcaaca cacgggcatt ttttctagtc aataataaag
ataatgattt caaacgattt ataatgcaac atattcacaa gtacataggt tgaaaaaaaa tccctatata tatatatata
cctattgcat catcactctt tctcaaaata acttcttcac aaaaataacc aagagaattt tcaacaagta ttagagcttt
ttgtgctcat tttgacattg ataataaaat atctcaattt atttcgagta cgtccgtgtc gttaagaatg ttctaaggat
ttggtaccca ttattttcct tactgtaaat acggctttat cgtcaatact gtttccaagg attctgtatt catttttttt
ctctcatcat aagcaacttt ttattctcct gtgacatttg gaataaacaa taagcaattt gaggaataac aatccaataa
gtataaatat aagcattaat catccaaact cagcacttgc tttaacattg catatttact taaatcaagt aaaagaatta
gtgtcatgca tcatctcact taaaagtaat atccaagcca catgaaaaga ctaaaatgca tacaagctaa catatcaaca
aatatacatc aattatttta ctagcatgca caagaatata ctagaggtat ataccaaagc tcttcttttt ctcatttttt
ttctttattt tcagatttag agcaatgcat ggatatagac atgaatgcac cgaaaaagca caaacttccc ctcaaataaa
cctccaattc tccctgaaga aaaatcaaga agaaatcaaa gattttgaaa aagacatcta attgccaatg atatcaccaa
ggttcttatg aattaacata tatccatttg aattaccaaa actacctctt caaacactag catgaaaagc ttataaacga
agaagtagaa caaagttatg tcaactcaaa agtacattga tgttaccttg aaaagaaatc accgtctccg cactaaacaa
tcatggggag tatgccgcca aaatacctat gaacatgaag atgttgaggc ctccgtgttg gcattagtca taaaaaaatt
tggaatccaa cactgaacca gtaggtacat atgcacgaac aaaatcggaa ccaaacatac ctgaaaactt accttgacgc
ttcacaaaaa tccgatttga attacgcgca aaatcgcccc gaggtcggtc tgatcgcagt tgtacctgca gtctgcccgg
gcctagtcgc cggtctgacc attgatatac ctgcagtctg accgccattg gcaactagta tgaccgattg gttagtgtcg
gtctaaccaa gctccttaat ccacaacctt gtttttgcca ctgtcgtttc gcaaaagcaa tttctctttc ctttttctgt
ttgcggacaa gtctaaaaca aaaaccaacc aaatattcat cttttccaaa aaaagaacaa gtgtatctct cacgacaaga
aatttttgaa gtagatggtt ttgcaatgaa agtctttttc tcttgagtcg tcgaagaaag agacggcaaa actccttagg
tttgggtttt gtacttcacc tttttcagtt atgctcaaga caacatatcg gtgatttgta aaatgggcat tggtatcaaa
acctacacca caattataag cactcacttt tgacttatcc aaatcatgtt aagtttcttc ttaccatcag aaaacctttc
caaataagaa acttcttttg tcaaattttc acaattttca tcatcaacca aaacaccatt gttctttgtg acaattagaa
caagaaagca cctcatcagc ttttacaaga tcctccatat actcaacacg ccctaaagca tctttcaatc tcatttcatt
caaaaaacac tttgagcaat ttggagaaac caaaacatat ttgtgttgtt taatccttta tgcactcaaa acattgaaca
aagaacacgc acaaaaagca actttatatt ttttttcaaa acgttctttt gtcaaagtca actcattaac aacatgagag
catgcaaagc aaatccaaga gaaaaagaca aataaagctt gttagttttt tcaacctcag attccaatct aaagcaatta
acataattgg catctcataa agcagtaatt tcagataata aagcttccca agatttgcaa tcatcatcat taggaaccat
agattttaat ctaacaattt cagcatttaa aattcaatag tgtggttact ctcattaagc aaattagaac atgttttcaa
tttctcagca aattttaaag caatatgttc ttattgatct taactaagct ttttttcact atcagattca ttaacatcag
agtctacatt gcgagcagta aaagccaaat caacaactta atcaacaact tgcttacctt tgctatggcg ctcatcttca
tcctctgatt cttcactatc aaaagcttct atcaattctt gaattAGCCT TTGCTTGCGA ATCTTCTTGC TCTCCTTCTT
CTTGTCATTC TTGTTCACTT TCTCCTCCAA GCTTGTCTTC TTGCGGTTAG GACAATTGAA CTTGATGTGA TTTAACTTGC
CACACTGAAA GCATTGAACA GATCCTCCTC GCTTCCTATT CTTGACTTTT TCAAAACCCT GAGAAAGTTT GTTAGTAACC
TAAACCAAGT CCTCCTCGAA TCACTCGAGT TGTTTATCGG ACATGGCTTT AATAAAATTA AGAGCTGATG AAGAAGAAGC
ACCAATGGAA GAACTCAAAG AAGAGATCAA GGCACTAATT TAAGGATCAA TCTTGCGGGA AAGAATATTC ACCTCATGAG
TTTTAAGCTT GGTGTAAAGA GAATCCAAAG TCAAAGCGGA CATGTTAACA GATTCCTAAA TTGAAGTCAC TTTCATCTCC
CAGATCGACA TATCAAGACC ATTCAAAAAG TGTCGAGAAA TCTCAGATTG TGTGTAATAA GTATCATAAG AGGAATCAAC
AGATCTAAGA TTACTCAAAA CTTTGTTAAA GCGTGCAAGA TAATCATCCA AAGTCTCTTC AGGTTGCATC TCAAATTTTA
CGTAATCCTT TTAAAAAGAT CTTTGCGCAC TTCATTGATA TTAGAAGTCC CTTGGTGAAA ATCAGATAAT GGCTTCCAAA
TCTCATGCGC GGTTTGCAGA TGAGAAACAC GATCAAAATC CGAACAAGGA ATTCCATTAA GCAAAATATT GCGAGCTTTG
CAATTGTTTT TAAAATCAGT CTTAAGAACA ACAGTATTAA TCTAAGCAGG AATTTTATAA GGATTTGCAA CTTTTTGCCA
AATATCATAA CTCTCAGACA TAATATAAGA TTTCTTTTCG CACCAATAAG GAAAATTGAC TCCATAAAAA ACATGTGGCC
AGGTCATAAA CTTGTTAGCC ATGGCAAGAA CTCAAGATCG GCAAAGATCA AATAGAGTGA ACATGGCTCT GATACCACTT
GTAAGATCGA AAAAAAAGAA CCAAGCCAAT CAGAGAGGGG TGAATGGTTG TAACACCAAA AATCAAAAAC TTTTAGCGGA
CATAGAAGTT ACCCTTGTTG ATGAAGTCAG TGCAACGCGG TCTGACCACC ATGTGCGCAC CGATCTGACC GCTCCTATGC
CGCTGGTCTG ACAGGTGTTG TCTGGCCGAT AAGACCACCG CCTCTCTACT TGTCACTGCT CGCCGCCGCC AGTCTGACTG
CTTGATTGCC GCTGGTGACC GCTCGTAATA CTTCGGTCAA ACCATCGACC GTCGAGATCC AGAAAACACC GATAGATGAA
AACTCTAAGA TGTAGATTAA TCTATCTCGA CTTTATTGCA TCAACTAGTG TTTACAAAGT GCACCAACAT CACTCCTCAC
CAAAATCTCG AACTAGACTT GATACCCAAA CTTATCTCTC AACTCAACTC TCTATCCATT GATACCGGCA GACAACATCC
TCCCTCTCTA TTTATACCGA TAACATGGCT GTCCCTAGCC ACGAATCCAA CTCATACAAA AAGTCCTTCC CGTATAAGAA
ACAAACTTTA CAAACTCTAG TCTTTCCAAA CTTGGACTCC GATCGAAATT TGACTCCTCT TTCCATATGC ACACAACACG
ATGTGTATGC CATATGGAAA CCTTCACCTC CATGTACATT GTTCTCTAGC TTGAGCATCC CGCATGACAT CCTTGACCGT
CTGGACCTCA ACTTCTTCCG AGCCTAGTCC TGATCCATCA CCGACTATAC TCCCATAGCC TCAAGCAACA CCTGCACATG
AATAACAATG AAACTCCATA TCTGAGTACA AGTTCACGCT AACTTGACTC ACATCAGCAT ACAATAGTAT CACATACGAA
TAGAAACCAT CTAGAAATAA TAAACATGAA TCAATCTAGA AATTCCATAA AAACAACCCG AAACCGACTC CCTCTTGGAA
TCACTCAGTC AGACCATCGG GCCGCCCGGT CTGACCGGTG CCTCCTGCCC GGTCTGACAA GCACCCGGTG CCGACCGCAG
TGTTCACCAT Tcgaaaatac tatccaccgt attttcaaca acacttaccg ttgacaattg ttcatcacca agattaatca
tcatatgatt ctacaacaga cagacacata ggcatgttca gagagatgcc atactaGAAT TGAAATGTCA AATTTTGGAA
GAGAAAAAAA AATAGTTAAT AAAAAAGAAA AAGAAAGAGC TACTCTCTGC ATTCATTCTT TCATGGCAAA ATTAATTTTA
CACGATCGCC AAAAGTAAAT TTGATCATTA ATTAATGTGA AATTAGTTTG ACAGGATGGC ATGTACTGAA TCTTATTTTA
TTATTGTGTT CATCCCTAAC AAAAAAACCG TACTTACTCT TTCCACTGTC GGTATCTGTC CTTTTAACCG GAAAATTCAT
CCATCCAAAC AAAAAATATC TGAAACAGGA TATTCGATGT TTTTCTGAAT GGAAAAGTAA GCCACATTGG GTACTCATTG
AAGCGCTTGT GCAAGGCCGC ACGCTTCATC GCGTTGCCCC ATAACCATAA GAAGGTTGGG TTCAGGGGTG CTGTTCGAGT
GCTTGTCTTC ACCATCGTCT TGTGTCCGCT GTTCCTGCTC TACATGTTTG GGCTCTTCGT TTCCCCCTGG ATTTCGCTGT
GGCGTCTAAT CCAGCAGGAT TACGGCGTGA CGGCCGGAGA CAGCAGCAGC AAGGCACACC TGCAGCCTGC GCTGGTGGTT
CTCTACTCCC TGGCCCTGTT CCAGGGCGTC CTCTTCTACT ACAGGGCCAT CTCTGCTTGG GAAGAACAGA AGCTAGTGAA
AGATGTGGCC GACAAATACA TGTTTGATAC AGTGTCGCGC AGTTCAGTTT CGGACTATTT ACATGAGATC AAGGTCGGAT
GTGAGAATGA CCCGTCCTTT GCCAGAGGGA GGAACCTGAT CACATACGCT GTCAAGCTGA TGGAATCCAC ATCACCGGAT
GGGTACCTTT CAGGTGCACG GATTCTTGAT ACACTCATCA AGTTTAATAG AGATGATGCA TCGGGGAGCG AATTACCGGG
GCAGAGTATG CAGATATACA ATATGATTGG ATCTGCATCC TCCAGTCCCA TACTCCACAA CTTAGTTCAG ATGCTGGATT
TCAAAAGTGC ATATGATGGA GAGATCAGGT TGCGAGCCGC AAGGATTGTT GAGCACTTTG CTGGTGAGGT CCGTTTAGAC
AAAATCCTGC AGGGGATTCG ATGTGTATCT TCCTTGCTTG AACTCGAGCA GAAAGGATTT CAGAATGACC ACCATAGTTC
TTTCCAAGAA GACGACGGCG ACCAACTTTC TTTTGAAGAA GAGGATGATC ACCAGATTTC TGTCAAAGAA AAGGATTATT
ACCCCAAAGA TTATAAACAG ATGCAACTTA CAGGCATGCA GATCCTTTTA AAGCTCTCCT ACGACAAGAA CAACTTGTTC
CTCATGAGCA ACACAGATGA TCCGGCCTTG ATCAACAAGA TTGTGGCACT TATAACGTCC AAGGGATCAC TTCACAAAAA
ACAACATAAC GAATGGTCCT GTATGGCAGA GCTCGGGGTG AAGATACTAA GCCGATTTAT GCGATTTATG TATGGCCCTA
CAAAATCAAA CAATATTCTG TGGCATGAAA TATCAACAAG CAGCAAAGCA ATCGGCACCT TGGAGAGTAT TCTTGAGTGT
GACCAATGTG ACTCTGTGCT GAAGAAACAC GCCATAAGGA TTCTCAAAAG GATATTCATG GATACATCTT CGGCTATGGG
TGAAGGAGAC AGAGAAAGGT TCATTGGCTC CTTGATGGAC ATGTCTCTTC ACAACAGTAA TGGTGACTTT CAAAATCTGG
CAGGTGTAGA TCTGGCGCTC AAGAAACAAG GGTTAAGCAT TCTCAAAGAA ATATACTTGA ATCCATCTTC GATTATGGGC
GAAGGAGACA GAGAAAGGTT CATCGGCTCC CTGATGGACA TGTTTCTTGA CAACAGTAAG GGCGACTTTG GAAATCTGCC
AGGTGAAGAT CTGGACCTCA AGAAACAAGA GTTAAGTATT CTCAAAGAAA TATGCATGGA TCCATCTTCG TTTATGGGCG
AAGGTGACAG AGAAAAATTC ATCGGCACCC TGATGGACAT GTTTCTTCAC AACAGCAAGG GCGACTTGTT TGAAAAACTA
GCAGGTGATG ATCTGGTGCA GATATGTAGA AGAAGTGGAA GCAGTGCCAC GATCATATTG AGGAAATATG GTCATGATAT
TGTTGATTGT ATTGCTGATA CTCGTTCAAG CGTATATAGC AGCATGCACA GAAAAATTGC AGCAAAGATC CTCAATCATC
TGTGTAGTCC CTACTCCACT GACGAGGAAC ATCTTCAGAA TCTGAAGGAG GCCATCATTG ATTTGATACC CAAGGTACGT
TAGTCGCTGT CATTTATACT TCTTATGTCA ACAAACATTT TTTTTCATGA TAATGAAATA TAACTCTGGC AGCCTCTACA
TTGTCAGATG CACGAAACCA TAGCTCATTA AATAGTTTGG CAACCTCTAC ATTCGCAGCA ATCCATGGGT AACAAACTTG
TTTAAAGCAA AACTGAAGCA CAACTTGTAT CATTAAAATT TCATCCATGC TTACTGAATA TCCATCAGAG TAGTCTCCAA
AAGATGGGAT ACTGCTTTTA TATGCATCCT ATTTATATCG GAATGACCGA AAGCACTGTA ATGTTGCAGG TGCTAAGAGA
AGCACTTGGT TGGGGGTTGA CAGGAGAAGA GATACTGCGA GTGGCAGTTT CAGGCCTTGA AGGTACCCAA GATGATGACT
GGAAATTGCA GGAAGCATTG GCGTCCCTCT GTGCAACCGT GTTTAACAGA ATTGTCAGCA AGGATGCAGA TTTGACTGCT
CGGTTCAACA ACATCGCCGC TGGTATCTGC GACCAGACAA CGAAGCCTCG CATGACCTTC GCAGACCTCA TCAATGAAGC
TGTAAAAGTT CATCGCATCG AATTTAAAAA ACCAGAAAAA CCAAAACCAG CTGCCAGGCC GGAACTGTAC GAGTTTGTGA
CTGCGAAATA CACCCCGCCC CACTTTATGT TTTTGGGCGA GGAAGATCCC AACGCGTGTT GTATCTCTTG ATAACACCCT
AATTTGtact ttctccgttt cacaatgtaa gtcattctat tatttcctat atttatatgg atattaatga atctatatat
atatatatat atatttgtct agatttatta acatc