Os12t0285100-04

Locus

Os12g0285100

Description

Hypothetical conserved gene.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

PTR

CGSNL Gene Name

PI-TA RESISTANCE

Oryzabase Gene Symbol Synonym(s)

Ptr, OsPtr, Ptr(t)

Oryzabase Gene Name Synonym(s)

Pi-ta resistance

Transcript Evidence

AK072022 (DDBJ, Best hit)

Protein Evidence

A2ZJL9 (UniProt)

Literature

Note

Manual Curation

Full-length cDNA

J013105F11 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0285100-04)

RiceXPro (AK072022)

Others

Oryzabase (23458)

KEGG (Os12t0285100-04)

Transcript

2222 bp

>Os12t0285100-04 Hypothetical conserved gene.
TTACGGCGTGACGGCCGGAGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGT
TCTCTACTCCCTGGCCCTGTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTG
GGAAGAACAGAAGCTAGTGAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCG
CAGTTCAGTTTCGGACTATTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTT
TGCCAGAGGGAGGAACCTGATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGA
TGGGTACCTTTCAGGTGCACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGC
ATCGGGGAGCGAATTACCGGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATC
CTCCAGTCCCATACTCCACAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGG
AGAGATCAGGTTGCGAGCCGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGA
CAAAATCCTGCAGGGGATTCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATT
TCAGAATGACCACCATAGTTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGA
AGAGGATGATCACCAGATTTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACA
GATGCAACTTACAGGCATGCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTT
CCTCATGAGCAACACAGATGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTC
CAAGGGATCACTTCACAAAAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGT
GAAGATACTAAGCCGATTTATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCT
GTGGCATGAAATATCAACAAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTG
TGACCAATGTGACTCTGTGCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCAT
GGATACATCTTCGGCTATGGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGA
CATGTCTCTTCACAACAGTAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCT
CAAGAAACAAGGGTTAAGCATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGG
CGAAGGAGACAGAGAAAGGTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAA
GGGCGACTTTGGAAATCTGCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTAT
TCTCAAAGAAATATGCATGGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATT
CATCGGCACCCTGATGGACATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACT
AGCAGGTGATGATCTGGTGCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATT
GAGGAAATATGGTCATGATATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAG
CAGCATGCACAGAAAAATTGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCAC
TGACGAGGAACATCTTCAGAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCT
AAGAGAAGCACTTGGTTGGGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGG
CCTTGAAGGTACCCAAGATGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGC
AACCGTGTTTAACAGAATTGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACAT
CGCCGCTGGTATCTGCGACCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAA
TGAAGCTGTAAAAGTTCATCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGC
CAGGCCGGAACTGTACGAGTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTT
GGGCGAGGAAGATCCCAACGCGTGTTGTATCTCTTGATAACACCCTAATTTGtactttct
ccgtttcacaatgtaagtcattctattatttcctatatttatatggatattaatgaatct
at

CDS

2136 bp

>Os12t0285100-04 Hypothetical conserved gene.
TACGGCGTGACGGCCGGAGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTT
CTCTACTCCCTGGCCCTGTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGG
GAAGAACAGAAGCTAGTGAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGC
AGTTCAGTTTCGGACTATTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTT
GCCAGAGGGAGGAACCTGATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGAT
GGGTACCTTTCAGGTGCACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCA
TCGGGGAGCGAATTACCGGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCC
TCCAGTCCCATACTCCACAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGA
GAGATCAGGTTGCGAGCCGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGAC
AAAATCCTGCAGGGGATTCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTT
CAGAATGACCACCATAGTTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAA
GAGGATGATCACCAGATTTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAG
ATGCAACTTACAGGCATGCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTC
CTCATGAGCAACACAGATGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCC
AAGGGATCACTTCACAAAAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTG
AAGATACTAAGCCGATTTATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTG
TGGCATGAAATATCAACAAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGT
GACCAATGTGACTCTGTGCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATG
GATACATCTTCGGCTATGGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGAC
ATGTCTCTTCACAACAGTAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTC
AAGAAACAAGGGTTAAGCATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGC
GAAGGAGACAGAGAAAGGTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAG
GGCGACTTTGGAAATCTGCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATT
CTCAAAGAAATATGCATGGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTC
ATCGGCACCCTGATGGACATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTA
GCAGGTGATGATCTGGTGCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTG
AGGAAATATGGTCATGATATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGC
AGCATGCACAGAAAAATTGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACT
GACGAGGAACATCTTCAGAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTA
AGAGAAGCACTTGGTTGGGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGC
CTTGAAGGTACCCAAGATGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCA
ACCGTGTTTAACAGAATTGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATC
GCCGCTGGTATCTGCGACCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAAT
GAAGCTGTAAAAGTTCATCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCC
AGGCCGGAACTGTACGAGTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTG
GGCGAGGAAGATCCCAACGCGTGTTGTATCTCTTGA

Protein

712 aa

>Os12t0285100-04 Hypothetical conserved gene.
YGVTAGDSSSKAHLQPALVVLYSLALFQGVLFYYRAISAWEEQKLVKDVADKYMFDTVSR
SSVSDYLHEIKVGCENDPSFARGRNLITYAVKLMESTSPDGYLSGARILDTLIKFNRDDA
SGSELPGQSMQIYNMIGSASSSPILHNLVQMLDFKSAYDGEIRLRAARIVEHFAGEVRLD
KILQGIRCVSSLLELEQKGFQNDHHSSFQEDDGDQLSFEEEDDHQISVKEKDYYPKDYKQ
MQLTGMQILLKLSYDKNNLFLMSNTDDPALINKIVALITSKGSLHKKQHNEWSCMAELGV
KILSRFMRFMYGPTKSNNILWHEISTSSKAIGTLESILECDQCDSVLKKHAIRILKRIFM
DTSSAMGEGDRERFIGSLMDMSLHNSNGDFQNLAGVDLALKKQGLSILKEIYLNPSSIMG
EGDRERFIGSLMDMFLDNSKGDFGNLPGEDLDLKKQELSILKEICMDPSSFMGEGDREKF
IGTLMDMFLHNSKGDLFEKLAGDDLVQICRRSGSSATIILRKYGHDIVDCIADTRSSVYS
SMHRKIAAKILNHLCSPYSTDEEHLQNLKEAIIDLIPKVLREALGWGLTGEEILRVAVSG
LEGTQDDDWKLQEALASLCATVFNRIVSKDADLTARFNNIAAGICDQTTKPRMTFADLIN
EAVKVHRIEFKKPEKPKPAARPELYEFVTAKYTPPHFMFLGEEDPNACCIS*

5'UTR

chr12:10831043..10831043 (+ strand) : 1 bp

CDS

chr12:10831044..10832777 (+ strand) : 1734 bp

chr12:10833093..10833494 (+ strand) : 402 bp

3'UTR

chr12:10833495..10833579 (+ strand) : 85 bp

FASTA

>Os12t0285100-04 class=Sequence position=chr12:10831043..10833579 (+ strand)
TTACGGCGTG ACGGCCGGAG ACAGCAGCAG CAAGGCACAC CTGCAGCCTG CGCTGGTGGT TCTCTACTCC CTGGCCCTGT
TCCAGGGCGT CCTCTTCTAC TACAGGGCCA TCTCTGCTTG GGAAGAACAG AAGCTAGTGA AAGATGTGGC CGACAAATAC
ATGTTTGATA CAGTGTCGCG CAGTTCAGTT TCGGACTATT TACATGAGAT CAAGGTCGGA TGTGAGAATG ACCCGTCCTT
TGCCAGAGGG AGGAACCTGA TCACATACGC TGTCAAGCTG ATGGAATCCA CATCACCGGA TGGGTACCTT TCAGGTGCAC
GGATTCTTGA TACACTCATC AAGTTTAATA GAGATGATGC ATCGGGGAGC GAATTACCGG GGCAGAGTAT GCAGATATAC
AATATGATTG GATCTGCATC CTCCAGTCCC ATACTCCACA ACTTAGTTCA GATGCTGGAT TTCAAAAGTG CATATGATGG
AGAGATCAGG TTGCGAGCCG CAAGGATTGT TGAGCACTTT GCTGGTGAGG TCCGTTTAGA CAAAATCCTG CAGGGGATTC
GATGTGTATC TTCCTTGCTT GAACTCGAGC AGAAAGGATT TCAGAATGAC CACCATAGTT CTTTCCAAGA AGACGACGGC
GACCAACTTT CTTTTGAAGA AGAGGATGAT CACCAGATTT CTGTCAAAGA AAAGGATTAT TACCCCAAAG ATTATAAACA
GATGCAACTT ACAGGCATGC AGATCCTTTT AAAGCTCTCC TACGACAAGA ACAACTTGTT CCTCATGAGC AACACAGATG
ATCCGGCCTT GATCAACAAG ATTGTGGCAC TTATAACGTC CAAGGGATCA CTTCACAAAA AACAACATAA CGAATGGTCC
TGTATGGCAG AGCTCGGGGT GAAGATACTA AGCCGATTTA TGCGATTTAT GTATGGCCCT ACAAAATCAA ACAATATTCT
GTGGCATGAA ATATCAACAA GCAGCAAAGC AATCGGCACC TTGGAGAGTA TTCTTGAGTG TGACCAATGT GACTCTGTGC
TGAAGAAACA CGCCATAAGG ATTCTCAAAA GGATATTCAT GGATACATCT TCGGCTATGG GTGAAGGAGA CAGAGAAAGG
TTCATTGGCT CCTTGATGGA CATGTCTCTT CACAACAGTA ATGGTGACTT TCAAAATCTG GCAGGTGTAG ATCTGGCGCT
CAAGAAACAA GGGTTAAGCA TTCTCAAAGA AATATACTTG AATCCATCTT CGATTATGGG CGAAGGAGAC AGAGAAAGGT
TCATCGGCTC CCTGATGGAC ATGTTTCTTG ACAACAGTAA GGGCGACTTT GGAAATCTGC CAGGTGAAGA TCTGGACCTC
AAGAAACAAG AGTTAAGTAT TCTCAAAGAA ATATGCATGG ATCCATCTTC GTTTATGGGC GAAGGTGACA GAGAAAAATT
CATCGGCACC CTGATGGACA TGTTTCTTCA CAACAGCAAG GGCGACTTGT TTGAAAAACT AGCAGGTGAT GATCTGGTGC
AGATATGTAG AAGAAGTGGA AGCAGTGCCA CGATCATATT GAGGAAATAT GGTCATGATA TTGTTGATTG TATTGCTGAT
ACTCGTTCAA GCGTATATAG CAGCATGCAC AGAAAAATTG CAGCAAAGAT CCTCAATCAT CTGTGTAGTC CCTACTCCAC
TGACGAGGAA CATCTTCAGA ATCTGAAGGA GGCCATCATT GATTTGATAC CCAAGGTACG TTAGTCGCTG TCATTTATAC
TTCTTATGTC AACAAACATT TTTTTTCATG ATAATGAAAT ATAACTCTGG CAGCCTCTAC ATTGTCAGAT GCACGAAACC
ATAGCTCATT AAATAGTTTG GCAACCTCTA CATTCGCAGC AATCCATGGG TAACAAACTT GTTTAAAGCA AAACTGAAGC
ACAACTTGTA TCATTAAAAT TTCATCCATG CTTACTGAAT ATCCATCAGA GTAGTCTCCA AAAGATGGGA TACTGCTTTT
ATATGCATCC TATTTATATC GGAATGACCG AAAGCACTGT AATGTTGCAG GTGCTAAGAG AAGCACTTGG TTGGGGGTTG
ACAGGAGAAG AGATACTGCG AGTGGCAGTT TCAGGCCTTG AAGGTACCCA AGATGATGAC TGGAAATTGC AGGAAGCATT
GGCGTCCCTC TGTGCAACCG TGTTTAACAG AATTGTCAGC AAGGATGCAG ATTTGACTGC TCGGTTCAAC AACATCGCCG
CTGGTATCTG CGACCAGACA ACGAAGCCTC GCATGACCTT CGCAGACCTC ATCAATGAAG CTGTAAAAGT TCATCGCATC
GAATTTAAAA AACCAGAAAA ACCAAAACCA GCTGCCAGGC CGGAACTGTA CGAGTTTGTG ACTGCGAAAT ACACCCCGCC
CCACTTTATG TTTTTGGGCG AGGAAGATCC CAACGCGTGT TGTATCTCTT GATAACACCC TAATTTGtac tttctccgtt
tcacaatgta agtcattcta ttatttccta tatttatatg gatattaatg aatctat