Os12t0285100-05

Locus

Os12g0285100

Description

Atypical resistance protein with Armadillo repeats, Broad-spectrum blast resistance

RAP-DB Gene Symbol Synonym(s)

Ptr

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

Oryzabase Gene Name Synonym(s)

Transcript Evidence

MG385190 (YT16)

Inferred from literature

Protein Evidence

A0A2U9K4Z4

Literature

PMID: 29795191

Note

Manual Curation

February 19, 2020

Functional domain (InterPro)

Armadillo-type fold (IPR016024)

Experimentally confirmed subcellular location

cytoplasm

Transcript

3413 bp

>Os12t0285100-05 Atypical resistance protein with Armadillo repeats, Broad-spectrum blast resistance
GCCACCACTGCTTTCCCTCCTCCTCATCCTCATCTTCATCTCTAGACCTCATCTTCTCCA
GCCACCACCGCCTCCCTTCCCACCGGTGGTGGCAGCGGGAAGACAGCGGCTCGGTTGAGC
CCGGCGGGGAGGGCACGATTTGGTATGGGAGGAGCAGCGGCGACTCCATCCGGCGGTGGA
TCCGCCGCCTCCTAGTCCCAGCTCTCTCTCCCCCGATCCTCCTCCTCCCCTTCCTCCACC
GCCACCACCCACCCCTCTCCCTCTCTCAGATCTGGTGCGCGGGGAGCGGTGGAGGCTACG
GCGGCGGCGGCGGCGAGATCGGTAGCAGTGATGGTGGAGAGGACGGATCCGATGGCGGTG
GTTCTCGTCAACCAGTTCAAGGACGACGACAGCAGCGGCTGCTGCAACGATGGATAGGCT
CTGGGCGGCTCCTCCACTCTCCTCCCCTCTCTCATATCCAGTGGCTCGGGGTGGTGGGGC
GTGGCCGACGCATCCGGCGGCGGAGCTCGGGTGTTTAGCGGAGGAAGGATCGATGTCCGG
CGCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGATTGGCCAGAGGT
CTTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTTGTCACCGGGAC
GGGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTCGTCTCCATGCT
ATCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACAAGGATATTCGA
TGTTTTTCTGAATGGAAAAGTAAGCCACATTGGGTACTCATTGAAGCGCTTGTGCAAGGC
CGCACGCTTCATCGCGTTGCCCCATAACCATAAGAAGGTTGGGTTCAGGGGTGCTGTTCG
AGTGCTTGTCTTCACCATCGTCTTGTGTCCGCTGTTCCTGCTCTACATGTTTGGGCTCTT
CGTTTCCCCCTGGATTTCGCTGTGGCGTCTAATCCAGCAGGATTACGGCGTGACGGCCGG
AGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTTCTCTACTCCCTGGCCCT
GTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGGGAAGAACAGAAGCTAGT
GAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGCAGTTCAGTTTCGGACTA
TTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTTGCCAGAGGGAGGAACCT
GATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGATGGGTACCTTTCAGGTGC
ACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCATCGGGGAGCGAATTACC
GGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCCTCCAGTCCCATACTCCA
CAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGAGAGATCAGGTTGCGAGC
CGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGACAAAATCCTGCAGGGGAT
TCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTTCAGAATGACCACCATAG
TTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAAGAGGATGATCACCAGAT
TTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAGATGCAACTTACAGGCAT
GCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTCCTCATGAGCAACACAGA
TGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCCAAGGGATCACTTCACAA
AAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTGAAGATACTAAGCCGATT
TATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTGTGGCATGAAATATCAAC
AAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGTGACCAATGTGACTCTGT
GCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATGGATACATCTTCGGCTAT
GGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGACATGTCTCTTCACAACAG
TAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTCAAGAAACAAGGGTTAAG
CATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGCGAAGGAGACAGAGAAAG
GTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAGGGCGACTTTGGAAATCT
GCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATTCTCAAAGAAATATGCAT
GGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTCATCGGCACCCTGATGGA
CATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTAGCAGGTGATGATCTGGT
GCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTGAGGAAATATGGTCATGA
TATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGCAGCATGCACAGAAAAAT
TGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACTGACGAGGAACATCTTCA
GAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTAAGAGAAGCACTTGGTTG
GGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGCCTTGAAGGTACCCAAGA
TGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCAACCGTGTTTAACAGAAT
TGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATCGCCGCTGGTATCTGCGA
CCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAATGAAGCTGTAAAAGTTCA
TCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCCAGGCCGGAACTGTACGA
GTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTGGGCGAGGAAGATCCCAA
CGCGTGTTGTATCTCTTGATAACACCCTAATTTGtactttctccgtttcacaatgtaagt
cattctattatttcctatatttatatggatattaatgaatctatatatatatatatatat
atttgtctagatttattaacatcaatatgaatgtggaaaatactgaatgacttacatttt
gaaacggagggagtaATGCAAACCGAGGATGAAAAAATATATATGCCTATACGGTACTGC
TCCATTTCCAAATAAATTCCCGTTCTGCTTTATGCTAGGTGGACCGTTTGTTG

CDS

2730 bp

>Os12t0285100-05 Atypical resistance protein with Armadillo repeats, Broad-spectrum blast resistance
ATGGATAGGCTCTGGGCGGCTCCTCCACTCTCCTCCCCTCTCTCATATCCAGTGGCTCGG
GGTGGTGGGGCGTGGCCGACGCATCCGGCGGCGGAGCTCGGGTGTTTAGCGGAGGAAGGA
TCGATGTCCGGCGCCGGACAGAGCCGTGGTCATCGCCTTGGATTACACATTGATTCGGAT
TGGCCAGAGGTCTTGTTGATCAATGACTATGCGGTGTTCATGGGGTACCTGTCGATGGTT
GTCACCGGGACGGGGTTCCTGGTGCTCACGTGGTCCACCGTCATCCTCCTCGGTGGATTC
GTCTCCATGCTATCCAACAAGGACTTCTGGAGTCTCACGGTGATCACGCTCGTTCAAACA
AGGATATTCGATGTTTTTCTGAATGGAAAAGTAAGCCACATTGGGTACTCATTGAAGCGC
TTGTGCAAGGCCGCACGCTTCATCGCGTTGCCCCATAACCATAAGAAGGTTGGGTTCAGG
GGTGCTGTTCGAGTGCTTGTCTTCACCATCGTCTTGTGTCCGCTGTTCCTGCTCTACATG
TTTGGGCTCTTCGTTTCCCCCTGGATTTCGCTGTGGCGTCTAATCCAGCAGGATTACGGC
GTGACGGCCGGAGACAGCAGCAGCAAGGCACACCTGCAGCCTGCGCTGGTGGTTCTCTAC
TCCCTGGCCCTGTTCCAGGGCGTCCTCTTCTACTACAGGGCCATCTCTGCTTGGGAAGAA
CAGAAGCTAGTGAAAGATGTGGCCGACAAATACATGTTTGATACAGTGTCGCGCAGTTCA
GTTTCGGACTATTTACATGAGATCAAGGTCGGATGTGAGAATGACCCGTCCTTTGCCAGA
GGGAGGAACCTGATCACATACGCTGTCAAGCTGATGGAATCCACATCACCGGATGGGTAC
CTTTCAGGTGCACGGATTCTTGATACACTCATCAAGTTTAATAGAGATGATGCATCGGGG
AGCGAATTACCGGGGCAGAGTATGCAGATATACAATATGATTGGATCTGCATCCTCCAGT
CCCATACTCCACAACTTAGTTCAGATGCTGGATTTCAAAAGTGCATATGATGGAGAGATC
AGGTTGCGAGCCGCAAGGATTGTTGAGCACTTTGCTGGTGAGGTCCGTTTAGACAAAATC
CTGCAGGGGATTCGATGTGTATCTTCCTTGCTTGAACTCGAGCAGAAAGGATTTCAGAAT
GACCACCATAGTTCTTTCCAAGAAGACGACGGCGACCAACTTTCTTTTGAAGAAGAGGAT
GATCACCAGATTTCTGTCAAAGAAAAGGATTATTACCCCAAAGATTATAAACAGATGCAA
CTTACAGGCATGCAGATCCTTTTAAAGCTCTCCTACGACAAGAACAACTTGTTCCTCATG
AGCAACACAGATGATCCGGCCTTGATCAACAAGATTGTGGCACTTATAACGTCCAAGGGA
TCACTTCACAAAAAACAACATAACGAATGGTCCTGTATGGCAGAGCTCGGGGTGAAGATA
CTAAGCCGATTTATGCGATTTATGTATGGCCCTACAAAATCAAACAATATTCTGTGGCAT
GAAATATCAACAAGCAGCAAAGCAATCGGCACCTTGGAGAGTATTCTTGAGTGTGACCAA
TGTGACTCTGTGCTGAAGAAACACGCCATAAGGATTCTCAAAAGGATATTCATGGATACA
TCTTCGGCTATGGGTGAAGGAGACAGAGAAAGGTTCATTGGCTCCTTGATGGACATGTCT
CTTCACAACAGTAATGGTGACTTTCAAAATCTGGCAGGTGTAGATCTGGCGCTCAAGAAA
CAAGGGTTAAGCATTCTCAAAGAAATATACTTGAATCCATCTTCGATTATGGGCGAAGGA
GACAGAGAAAGGTTCATCGGCTCCCTGATGGACATGTTTCTTGACAACAGTAAGGGCGAC
TTTGGAAATCTGCCAGGTGAAGATCTGGACCTCAAGAAACAAGAGTTAAGTATTCTCAAA
GAAATATGCATGGATCCATCTTCGTTTATGGGCGAAGGTGACAGAGAAAAATTCATCGGC
ACCCTGATGGACATGTTTCTTCACAACAGCAAGGGCGACTTGTTTGAAAAACTAGCAGGT
GATGATCTGGTGCAGATATGTAGAAGAAGTGGAAGCAGTGCCACGATCATATTGAGGAAA
TATGGTCATGATATTGTTGATTGTATTGCTGATACTCGTTCAAGCGTATATAGCAGCATG
CACAGAAAAATTGCAGCAAAGATCCTCAATCATCTGTGTAGTCCCTACTCCACTGACGAG
GAACATCTTCAGAATCTGAAGGAGGCCATCATTGATTTGATACCCAAGGTGCTAAGAGAA
GCACTTGGTTGGGGGTTGACAGGAGAAGAGATACTGCGAGTGGCAGTTTCAGGCCTTGAA
GGTACCCAAGATGATGACTGGAAATTGCAGGAAGCATTGGCGTCCCTCTGTGCAACCGTG
TTTAACAGAATTGTCAGCAAGGATGCAGATTTGACTGCTCGGTTCAACAACATCGCCGCT
GGTATCTGCGACCAGACAACGAAGCCTCGCATGACCTTCGCAGACCTCATCAATGAAGCT
GTAAAAGTTCATCGCATCGAATTTAAAAAACCAGAAAAACCAAAACCAGCTGCCAGGCCG
GAACTGTACGAGTTTGTGACTGCGAAATACACCCCGCCCCACTTTATGTTTTTGGGCGAG
GAAGATCCCAACGCGTGTTGTATCTCTTGA

Protein

910 aa

>Os12t0285100-05 Atypical resistance protein with Armadillo repeats, Broad-spectrum blast resistance
MDRLWAAPPLSSPLSYPVARGGGAWPTHPAAELGCLAEEGSMSGAGQSRGHRLGLHIDSD
WPEVLLINDYAVFMGYLSMVVTGTGFLVLTWSTVILLGGFVSMLSNKDFWSLTVITLVQT
RIFDVFLNGKVSHIGYSLKRLCKAARFIALPHNHKKVGFRGAVRVLVFTIVLCPLFLLYM
FGLFVSPWISLWRLIQQDYGVTAGDSSSKAHLQPALVVLYSLALFQGVLFYYRAISAWEE
QKLVKDVADKYMFDTVSRSSVSDYLHEIKVGCENDPSFARGRNLITYAVKLMESTSPDGY
LSGARILDTLIKFNRDDASGSELPGQSMQIYNMIGSASSSPILHNLVQMLDFKSAYDGEI
RLRAARIVEHFAGEVRLDKILQGIRCVSSLLELEQKGFQNDHHSSFQEDDGDQLSFEEED
DHQISVKEKDYYPKDYKQMQLTGMQILLKLSYDKNNLFLMSNTDDPALINKIVALITSKG
SLHKKQHNEWSCMAELGVKILSRFMRFMYGPTKSNNILWHEISTSSKAIGTLESILECDQ
CDSVLKKHAIRILKRIFMDTSSAMGEGDRERFIGSLMDMSLHNSNGDFQNLAGVDLALKK
QGLSILKEIYLNPSSIMGEGDRERFIGSLMDMFLDNSKGDFGNLPGEDLDLKKQELSILK
EICMDPSSFMGEGDREKFIGTLMDMFLHNSKGDLFEKLAGDDLVQICRRSGSSATIILRK
YGHDIVDCIADTRSSVYSSMHRKIAAKILNHLCSPYSTDEEHLQNLKEAIIDLIPKVLRE
ALGWGLTGEEILRVAVSGLEGTQDDDWKLQEALASLCATVFNRIVSKDADLTARFNNIAA
GICDQTTKPRMTFADLINEAVKVHRIEFKKPEKPKPAARPELYEFVTAKYTPPHFMFLGE
EDPNACCIS*

5'UTR

chr12:10822534..10822942 (+ strand) : 409 bp

CDS

chr12:10822943..10823043 (+ strand) : 101 bp

chr12:10824065..10824325 (+ strand) : 261 bp

chr12:10830812..10832777 (+ strand) : 1966 bp

chr12:10833093..10833494 (+ strand) : 402 bp

3'UTR

chr12:10833495..10833768 (+ strand) : 274 bp

FASTA

>Os12t0285100-05 class=Sequence position=chr12:10822534..10833768 (+ strand)
GCCACCACTG CTTTCCCTCC TCCTCATCCT CATCTTCATC TCTAGACCTC ATCTTCTCCA GCCACCACCG CCTCCCTTCC
CACCGGTGGT GGCAGCGGGA AGACAGCGGC TCGGTTGAGC CCGGCGGGGA GGGCACGATT TGGTATGGGA GGAGCAGCGG
CGACTCCATC CGGCGGTGGA TCCGCCGCCT CCTAGTCCCA GCTCTCTCTC CCCCGATCCT CCTCCTCCCC TTCCTCCACC
GCCACCACCC ACCCCTCTCC CTCTCTCAGA TCTGGTGCGC GGGGAGCGGT GGAGGCTACG GCGGCGGCGG CGGCGAGATC
GGTAGCAGTG ATGGTGGAGA GGACGGATCC GATGGCGGTG GTTCTCGTCA ACCAGTTCAA GGACGACGAC AGCAGCGGCT
GCTGCAACGA TGGATAGGCT CTGGGCGGCT CCTCCACTCT CCTCCCCTCT CTCATATCCA GTGGCTCGGG GTGGTGGGGC
GTGGCCGACG CATCCGGCGG CGGAGCTCGG GTATCGATCC GGCATGTTTT TTTTTCTCCA AAATCAATTT TTCTTGGTGG
TCGGGAAACG GATTTTCAAT TTTCTTTTTT TCGCTCGAAT ATCTTTTTCG CTGGCGGTCA ACGTAACTTA ACCGCTTGTG
AAAACAAGCT TTAAAGTTTc gctagtgaag attgttattt tcacttgcca tttgtttgcg ggcggctgac agtgccacca
gcgaaaaACT CTTTTGCTAG TAGTGATTGC TAGATGGTCA GCAGAGAACT TGTGGAGCAT ATGACTATCA ACTAACAGTA
CACTTCAGCA GAAAGAGGAT GGTTCTAGCT CTCCGATGGT TTAATATTGA AACGTACAGC CCACCCACCA CCACCCCAGT
CGTCCCCAGC TAAGCGCTCC CTTGCTTGCC TCAGTAGACG AGCTGCCAAC TAGTAGCACT CCAGCAAGCA GCGGGTCAGC
GGAGTCCGGA GGGCGCACGT GCGCCGCAGC GAGGTATCAG CATGGCCAGG CGGCGGCTGG CTGGCCGGCC GGGTTCGGCA
AGCGGCTAAG CAGGTAATTA AGGGACTGCA GATACTGCTT GTGATCATCC CTTAAAATTT CGTCTTTCTT GTCTTGggcc
aggtttaatt cctaattttt tcttcaaact ttcaactttt ccatcacatc aaaacttttc tacacacaca aactttcaac
ttaattttcc gtcacatcgt tccaatttca atcaaacttc taattttagc gtgaactaaa cacaccctTG GTTGTGACTC
TGGGAGTCGA TACATAGGCC TTAATGCTCG TAGTTTGTGG ATTTTGGGGT TAAACTGGCG TGGAACTTTA CTTGGATACC
ACCTGGGAGT TGATGTGATT TTAGTGTTTA GTACAGTTTA GAGTTTATTA CCTACCGGTT TCTTGGTGCC TGGCGCACAC
TGAGCATGCA AATGCAGTGA GAGCCAGTAT CATCTAAGAC GGCTGGACCT GAAATATTTT ACCATGTATA TATCAAACTC
GACTTGATCA GGTGTTTAGC GGAGGAAGGA TCGATGTCCG GCGCCGGACA GAGCCGTGGT CATCGCCTTG GATTACACAT
TGATTCGGAT TGGCCAGAGG TCTTGTTGAT CAATGACTAT GCGGTGTTCA TGGGGTACCT GTCGATGGTT GTCACCGGGA
CGGGGTTCCT GGTGCTCACG TGGTCCACCG TCATCCTCCT CGGTGGATTC GTCTCCATGC TATCCAACAA GGACTTCTGG
AGTCTCACGG TGATCACGCT CGTTCAAACA AGGTGAGCTA TCTATAGCCA TCTCCACCAG ACTTATATTT ATTTCGCGTT
CCCAACATTA ACCAGTTCAG CCAAGCATTT GGAGTTTCGC ATTGCTAGCT AGCTACTAGT TTACTGTCAG ATCTAGTGTT
GCGAACCGAA TATGCTGCAA AACGTTGCAA TTCCAGAGTG GCTTTATATA CTACATTGAT ATGAAAATAT TCAAGTCCCA
TATTTGcaaa atcaactatt tttaaaatcg aattattttc tccccttttc aagaagcatg tattttgtat atttctctcc
ccatttgata ataatttcat caagaatttt aaaagagaat ataaccaata aagcacaaat gtcatgattt catgattgtg
acatgtaata atcacttctt ttttaatttt tattttaatt ttctgaaatt tttttgagag ctttgaagtg tacctaaagc
aatgcaattc atggtcatat gttgcaagac aaatgagata aattcatcaa ctagttaaca agcatgcatt agagtataaa
catgaatcaa aggtattaca attaagctca aatctctact attataaaaa ttgaagatgt ttttgccggt ggcttggtaa
gtcgtcatgt ccgaatTAGC CTCGCACATA ATTACTGCCA ATTTAATTAT TTATGTGCCC CACATGTATG AGCTTTAAAC
ATTAGATTTT CCATAAGAAA ATTTGCTTGT TCGGATCAGT GCCTTTGGCC GATTGCGTTT CATCCTGTGC ATTGTCACGA
ACCAACCACC ACCGCGAGGT TGTCATCTTG CTGATACGGT CTGTTCGGCA ACACGGTTTG GGACCTGCTG TCGTGCACCT
ATATCAACAC CAACCAGCAG CAGTCAGGTG TGTTGCCGTG CGCCGAGGCA AGCAGCACGA CGTACCATTG TTGATTATTC
TCTACACGCA CACACCGTAT CGAGAAGAAT TCCTACTGTG TTCATCAGAA ACTCAATCCA ATATTGTCTA CTGTGTATAC
GTGTTCCAAA AAGATTAAAG AAAAGATCAG GATCGATATC AAAGCCGAGA TCTATTACTA CCCACATATC GAAAATCCAC
GCGTGCAGCA AGACGATCAG CAACAGCAGC CGATCGATGA CGGTTGCCAA GAGAAATACG AAAACCTAAT CAGAGAAATA
TTCAATCAAG CTACTGCGCA CATATATCTT TACCTCTTAA ATTATATTTC TATctctact attataaaaa ttgtagatgt
tttcgtcagt attttagtac gtcatccgcg tatgagtcgg tttttaagtc cgtttgattt tggaaataca aatccgtatt
tgagtcagtt tttaagttcg ttcgcttttg gaaatacaga agaaatcgta taagaaatct ctttaaaaac tcacatacta
ctaacttgag acgttcggac acctaattac agctcatgat tttctaacac aatatatatc caagcgaatt tgacacagtg
aatttcatct taactcgata taatataata agattaaaat aatcttcacc cgttgcaaca cacgggcatt ttttctagtc
aataataaag ataatgattt caaacgattt ataatgcaac atattcacaa gtacataggt tgaaaaaaaa tccctatata
tatatatata cctattgcat catcactctt tctcaaaata acttcttcac aaaaataacc aagagaattt tcaacaagta
ttagagcttt ttgtgctcat tttgacattg ataataaaat atctcaattt atttcgagta cgtccgtgtc gttaagaatg
ttctaaggat ttggtaccca ttattttcct tactgtaaat acggctttat cgtcaatact gtttccaagg attctgtatt
catttttttt ctctcatcat aagcaacttt ttattctcct gtgacatttg gaataaacaa taagcaattt gaggaataac
aatccaataa gtataaatat aagcattaat catccaaact cagcacttgc tttaacattg catatttact taaatcaagt
aaaagaatta gtgtcatgca tcatctcact taaaagtaat atccaagcca catgaaaaga ctaaaatgca tacaagctaa
catatcaaca aatatacatc aattatttta ctagcatgca caagaatata ctagaggtat ataccaaagc tcttcttttt
ctcatttttt ttctttattt tcagatttag agcaatgcat ggatatagac atgaatgcac cgaaaaagca caaacttccc
ctcaaataaa cctccaattc tccctgaaga aaaatcaaga agaaatcaaa gattttgaaa aagacatcta attgccaatg
atatcaccaa ggttcttatg aattaacata tatccatttg aattaccaaa actacctctt caaacactag catgaaaagc
ttataaacga agaagtagaa caaagttatg tcaactcaaa agtacattga tgttaccttg aaaagaaatc accgtctccg
cactaaacaa tcatggggag tatgccgcca aaatacctat gaacatgaag atgttgaggc ctccgtgttg gcattagtca
taaaaaaatt tggaatccaa cactgaacca gtaggtacat atgcacgaac aaaatcggaa ccaaacatac ctgaaaactt
accttgacgc ttcacaaaaa tccgatttga attacgcgca aaatcgcccc gaggtcggtc tgatcgcagt tgtacctgca
gtctgcccgg gcctagtcgc cggtctgacc attgatatac ctgcagtctg accgccattg gcaactagta tgaccgattg
gttagtgtcg gtctaaccaa gctccttaat ccacaacctt gtttttgcca ctgtcgtttc gcaaaagcaa tttctctttc
ctttttctgt ttgcggacaa gtctaaaaca aaaaccaacc aaatattcat cttttccaaa aaaagaacaa gtgtatctct
cacgacaaga aatttttgaa gtagatggtt ttgcaatgaa agtctttttc tcttgagtcg tcgaagaaag agacggcaaa
actccttagg tttgggtttt gtacttcacc tttttcagtt atgctcaaga caacatatcg gtgatttgta aaatgggcat
tggtatcaaa acctacacca caattataag cactcacttt tgacttatcc aaatcatgtt aagtttcttc ttaccatcag
aaaacctttc caaataagaa acttcttttg tcaaattttc acaattttca tcatcaacca aaacaccatt gttctttgtg
acaattagaa caagaaagca cctcatcagc ttttacaaga tcctccatat actcaacacg ccctaaagca tctttcaatc
tcatttcatt caaaaaacac tttgagcaat ttggagaaac caaaacatat ttgtgttgtt taatccttta tgcactcaaa
acattgaaca aagaacacgc acaaaaagca actttatatt ttttttcaaa acgttctttt gtcaaagtca actcattaac
aacatgagag catgcaaagc aaatccaaga gaaaaagaca aataaagctt gttagttttt tcaacctcag attccaatct
aaagcaatta acataattgg catctcataa agcagtaatt tcagataata aagcttccca agatttgcaa tcatcatcat
taggaaccat agattttaat ctaacaattt cagcatttaa aattcaatag tgtggttact ctcattaagc aaattagaac
atgttttcaa tttctcagca aattttaaag caatatgttc ttattgatct taactaagct ttttttcact atcagattca
ttaacatcag agtctacatt gcgagcagta aaagccaaat caacaactta atcaacaact tgcttacctt tgctatggcg
ctcatcttca tcctctgatt cttcactatc aaaagcttct atcaattctt gaattAGCCT TTGCTTGCGA ATCTTCTTGC
TCTCCTTCTT CTTGTCATTC TTGTTCACTT TCTCCTCCAA GCTTGTCTTC TTGCGGTTAG GACAATTGAA CTTGATGTGA
TTTAACTTGC CACACTGAAA GCATTGAACA GATCCTCCTC GCTTCCTATT CTTGACTTTT TCAAAACCCT GAGAAAGTTT
GTTAGTAACC TAAACCAAGT CCTCCTCGAA TCACTCGAGT TGTTTATCGG ACATGGCTTT AATAAAATTA AGAGCTGATG
AAGAAGAAGC ACCAATGGAA GAACTCAAAG AAGAGATCAA GGCACTAATT TAAGGATCAA TCTTGCGGGA AAGAATATTC
ACCTCATGAG TTTTAAGCTT GGTGTAAAGA GAATCCAAAG TCAAAGCGGA CATGTTAACA GATTCCTAAA TTGAAGTCAC
TTTCATCTCC CAGATCGACA TATCAAGACC ATTCAAAAAG TGTCGAGAAA TCTCAGATTG TGTGTAATAA GTATCATAAG
AGGAATCAAC AGATCTAAGA TTACTCAAAA CTTTGTTAAA GCGTGCAAGA TAATCATCCA AAGTCTCTTC AGGTTGCATC
TCAAATTTTA CGTAATCCTT TTAAAAAGAT CTTTGCGCAC TTCATTGATA TTAGAAGTCC CTTGGTGAAA ATCAGATAAT
GGCTTCCAAA TCTCATGCGC GGTTTGCAGA TGAGAAACAC GATCAAAATC CGAACAAGGA ATTCCATTAA GCAAAATATT
GCGAGCTTTG CAATTGTTTT TAAAATCAGT CTTAAGAACA ACAGTATTAA TCTAAGCAGG AATTTTATAA GGATTTGCAA
CTTTTTGCCA AATATCATAA CTCTCAGACA TAATATAAGA TTTCTTTTCG CACCAATAAG GAAAATTGAC TCCATAAAAA
ACATGTGGCC AGGTCATAAA CTTGTTAGCC ATGGCAAGAA CTCAAGATCG GCAAAGATCA AATAGAGTGA ACATGGCTCT
GATACCACTT GTAAGATCGA AAAAAAAGAA CCAAGCCAAT CAGAGAGGGG TGAATGGTTG TAACACCAAA AATCAAAAAC
TTTTAGCGGA CATAGAAGTT ACCCTTGTTG ATGAAGTCAG TGCAACGCGG TCTGACCACC ATGTGCGCAC CGATCTGACC
GCTCCTATGC CGCTGGTCTG ACAGGTGTTG TCTGGCCGAT AAGACCACCG CCTCTCTACT TGTCACTGCT CGCCGCCGCC
AGTCTGACTG CTTGATTGCC GCTGGTGACC GCTCGTAATA CTTCGGTCAA ACCATCGACC GTCGAGATCC AGAAAACACC
GATAGATGAA AACTCTAAGA TGTAGATTAA TCTATCTCGA CTTTATTGCA TCAACTAGTG TTTACAAAGT GCACCAACAT
CACTCCTCAC CAAAATCTCG AACTAGACTT GATACCCAAA CTTATCTCTC AACTCAACTC TCTATCCATT GATACCGGCA
GACAACATCC TCCCTCTCTA TTTATACCGA TAACATGGCT GTCCCTAGCC ACGAATCCAA CTCATACAAA AAGTCCTTCC
CGTATAAGAA ACAAACTTTA CAAACTCTAG TCTTTCCAAA CTTGGACTCC GATCGAAATT TGACTCCTCT TTCCATATGC
ACACAACACG ATGTGTATGC CATATGGAAA CCTTCACCTC CATGTACATT GTTCTCTAGC TTGAGCATCC CGCATGACAT
CCTTGACCGT CTGGACCTCA ACTTCTTCCG AGCCTAGTCC TGATCCATCA CCGACTATAC TCCCATAGCC TCAAGCAACA
CCTGCACATG AATAACAATG AAACTCCATA TCTGAGTACA AGTTCACGCT AACTTGACTC ACATCAGCAT ACAATAGTAT
CACATACGAA TAGAAACCAT CTAGAAATAA TAAACATGAA TCAATCTAGA AATTCCATAA AAACAACCCG AAACCGACTC
CCTCTTGGAA TCACTCAGTC AGACCATCGG GCCGCCCGGT CTGACCGGTG CCTCCTGCCC GGTCTGACAA GCACCCGGTG
CCGACCGCAG TGTTCACCAT Tcgaaaatac tatccaccgt attttcaaca acacttaccg ttgacaattg ttcatcacca
agattaatca tcatatgatt ctacaacaga cagacacata ggcatgttca gagagatgcc atactaGAAT TGAAATGTCA
AATTTTGGAA GAGAAAAAAA AATAGTTAAT AAAAAAGAAA AAGAAAGAGC TACTCTCTGC ATTCATTCTT TCATGGCAAA
ATTAATTTTA CACGATCGCC AAAAGTAAAT TTGATCATTA ATTAATGTGA AATTAGTTTG ACAGGATGGC ATGTACTGAA
TCTTATTTTA TTATTGTGTT CATCCCTAAC AAAAAAACCG TACTTACTCT TTCCACTGTC GGTATCTGTC CTTTTAACCG
GAAAATTCAT CCATCCAAAC AAAAAATATC TGAAACAGGA TATTCGATGT TTTTCTGAAT GGAAAAGTAA GCCACATTGG
GTACTCATTG AAGCGCTTGT GCAAGGCCGC ACGCTTCATC GCGTTGCCCC ATAACCATAA GAAGGTTGGG TTCAGGGGTG
CTGTTCGAGT GCTTGTCTTC ACCATCGTCT TGTGTCCGCT GTTCCTGCTC TACATGTTTG GGCTCTTCGT TTCCCCCTGG
ATTTCGCTGT GGCGTCTAAT CCAGCAGGAT TACGGCGTGA CGGCCGGAGA CAGCAGCAGC AAGGCACACC TGCAGCCTGC
GCTGGTGGTT CTCTACTCCC TGGCCCTGTT CCAGGGCGTC CTCTTCTACT ACAGGGCCAT CTCTGCTTGG GAAGAACAGA
AGCTAGTGAA AGATGTGGCC GACAAATACA TGTTTGATAC AGTGTCGCGC AGTTCAGTTT CGGACTATTT ACATGAGATC
AAGGTCGGAT GTGAGAATGA CCCGTCCTTT GCCAGAGGGA GGAACCTGAT CACATACGCT GTCAAGCTGA TGGAATCCAC
ATCACCGGAT GGGTACCTTT CAGGTGCACG GATTCTTGAT ACACTCATCA AGTTTAATAG AGATGATGCA TCGGGGAGCG
AATTACCGGG GCAGAGTATG CAGATATACA ATATGATTGG ATCTGCATCC TCCAGTCCCA TACTCCACAA CTTAGTTCAG
ATGCTGGATT TCAAAAGTGC ATATGATGGA GAGATCAGGT TGCGAGCCGC AAGGATTGTT GAGCACTTTG CTGGTGAGGT
CCGTTTAGAC AAAATCCTGC AGGGGATTCG ATGTGTATCT TCCTTGCTTG AACTCGAGCA GAAAGGATTT CAGAATGACC
ACCATAGTTC TTTCCAAGAA GACGACGGCG ACCAACTTTC TTTTGAAGAA GAGGATGATC ACCAGATTTC TGTCAAAGAA
AAGGATTATT ACCCCAAAGA TTATAAACAG ATGCAACTTA CAGGCATGCA GATCCTTTTA AAGCTCTCCT ACGACAAGAA
CAACTTGTTC CTCATGAGCA ACACAGATGA TCCGGCCTTG ATCAACAAGA TTGTGGCACT TATAACGTCC AAGGGATCAC
TTCACAAAAA ACAACATAAC GAATGGTCCT GTATGGCAGA GCTCGGGGTG AAGATACTAA GCCGATTTAT GCGATTTATG
TATGGCCCTA CAAAATCAAA CAATATTCTG TGGCATGAAA TATCAACAAG CAGCAAAGCA ATCGGCACCT TGGAGAGTAT
TCTTGAGTGT GACCAATGTG ACTCTGTGCT GAAGAAACAC GCCATAAGGA TTCTCAAAAG GATATTCATG GATACATCTT
CGGCTATGGG TGAAGGAGAC AGAGAAAGGT TCATTGGCTC CTTGATGGAC ATGTCTCTTC ACAACAGTAA TGGTGACTTT
CAAAATCTGG CAGGTGTAGA TCTGGCGCTC AAGAAACAAG GGTTAAGCAT TCTCAAAGAA ATATACTTGA ATCCATCTTC
GATTATGGGC GAAGGAGACA GAGAAAGGTT CATCGGCTCC CTGATGGACA TGTTTCTTGA CAACAGTAAG GGCGACTTTG
GAAATCTGCC AGGTGAAGAT CTGGACCTCA AGAAACAAGA GTTAAGTATT CTCAAAGAAA TATGCATGGA TCCATCTTCG
TTTATGGGCG AAGGTGACAG AGAAAAATTC ATCGGCACCC TGATGGACAT GTTTCTTCAC AACAGCAAGG GCGACTTGTT
TGAAAAACTA GCAGGTGATG ATCTGGTGCA GATATGTAGA AGAAGTGGAA GCAGTGCCAC GATCATATTG AGGAAATATG
GTCATGATAT TGTTGATTGT ATTGCTGATA CTCGTTCAAG CGTATATAGC AGCATGCACA GAAAAATTGC AGCAAAGATC
CTCAATCATC TGTGTAGTCC CTACTCCACT GACGAGGAAC ATCTTCAGAA TCTGAAGGAG GCCATCATTG ATTTGATACC
CAAGGTACGT TAGTCGCTGT CATTTATACT TCTTATGTCA ACAAACATTT TTTTTCATGA TAATGAAATA TAACTCTGGC
AGCCTCTACA TTGTCAGATG CACGAAACCA TAGCTCATTA AATAGTTTGG CAACCTCTAC ATTCGCAGCA ATCCATGGGT
AACAAACTTG TTTAAAGCAA AACTGAAGCA CAACTTGTAT CATTAAAATT TCATCCATGC TTACTGAATA TCCATCAGAG
TAGTCTCCAA AAGATGGGAT ACTGCTTTTA TATGCATCCT ATTTATATCG GAATGACCGA AAGCACTGTA ATGTTGCAGG
TGCTAAGAGA AGCACTTGGT TGGGGGTTGA CAGGAGAAGA GATACTGCGA GTGGCAGTTT CAGGCCTTGA AGGTACCCAA
GATGATGACT GGAAATTGCA GGAAGCATTG GCGTCCCTCT GTGCAACCGT GTTTAACAGA ATTGTCAGCA AGGATGCAGA
TTTGACTGCT CGGTTCAACA ACATCGCCGC TGGTATCTGC GACCAGACAA CGAAGCCTCG CATGACCTTC GCAGACCTCA
TCAATGAAGC TGTAAAAGTT CATCGCATCG AATTTAAAAA ACCAGAAAAA CCAAAACCAG CTGCCAGGCC GGAACTGTAC
GAGTTTGTGA CTGCGAAATA CACCCCGCCC CACTTTATGT TTTTGGGCGA GGAAGATCCC AACGCGTGTT GTATCTCTTG
ATAACACCCT AATTTGtact ttctccgttt cacaatgtaa gtcattctat tatttcctat atttatatgg atattaatga
atctatatat atatatatat atatttgtct agatttatta acatcaatat gaatgtggaa aatactgaat gacttacatt
ttgaaacgga gggagtaATG CAAACCGAGG ATGAAAAAAT ATATATGCCT ATACGGTACT GCTCCATTTC CAAATAAATT
CCCGTTCTGC TTTATGCTAG GTGGACCGTT TGTTG