Os12t0454800-01

Locus

Os12g0454800

Description

Receptor-like serine/threonine kinase, Cytokinin signaling

RAP-DB Gene Symbol Synonym(s)

CRL4, CHARK, S/T kinase, OsCRL4, OsHKL1, OsCDP

RAP-DB Gene Name Synonym(s)

CHASE DOMAIN RECEPTOR-LIKE SERINE/THREONINE KINASE, CHASE domain receptor-like serine/threonine kinase, CHASE domain protein

CGSNL Gene Symbol

CRL4

CGSNL Gene Name

CHASE DOMAIN RECEPTOR-LIKE SERINE/THREONINE KINASE

Oryzabase Gene Symbol Synonym(s)

CHARK, S/T kinase, OsCRL4, OsHKL1, OsCDP

Oryzabase Gene Name Synonym(s)

CHASE domain receptor-like serine/threonine kinase, CHASE domain protein

Transcript Evidence

AK122032 (Genbank)

Protein Evidence

Q2QRN7 (UniProt)

Literature

PMID: 16919402

Note

Manual Curation

September 14, 2009

Gene Ontology (GO)

Biological Process: protein phosphorylation (GO:0006468)

Molecular Function: protein kinase activity (GO:0004672)

Molecular Function: protein serine/threonine kinase activity (GO:0004674)

Molecular Function: protein tyrosine kinase activity (GO:0004713)

Molecular Function: ATP binding (GO:0005524)

Molecular Function: transferase activity, transferring phosphorus-containing groups (GO:0016772)

Functional domain (InterPro)

Protein kinase, catalytic domain (IPR000719)

Serine/threonine-protein kinase, catalytic domain (IPR002290)

CHASE (IPR006189)

Serine/threonine-protein kinase, active site (IPR008271)

Protein kinase-like domain (IPR011009)

Serine/threonine-protein kinase-like domain (IPR017442)

Tyrosine-protein kinase, catalytic domain (IPR020635)

Full-length cDNA

J033112G09 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0454800-01)

RiceXPro (AK122032)

Others

Oryzabase (8123)

KEGG (Os12t0454800-01)

Transcript

3451 bp

>Os12t0454800-01 Receptor-like serine/threonine kinase, Cytokinin signaling
GTTGATCGCGCGGACGACACCCCCATGTCGTGGACGCAGAGCGCTAAGGACGGCTGCCGC
AGCCGAGCCAAGGCATCAGCGGATCGAGCGCGATTCTGCTCTGCGGGGAGCCCCGACGAC
TGGGGCGGGGTTGGAGGAGGAGAACAGCACGGCTGCCTGGCTTGCCTGGTTGTGGCTGCT
GCTGCTACCGTTGAAGCTGTCGGTTCACCGGCAGCGCCTGCCACTGGATGGCGCTACTGC
TCTGGGTGTTCAGCTGCTCGCTCTTCTCCTTGTGGATCCTCTCGTTCATGAGGTCCCAGG
CCACCGAGGCGCGCCACGGGACGCTCGCCGTCATGTGCGACGAGCGCGCCCGGATCCTCC
AGGACCAGGTGAAGGTGAGCATGAACCACCTCCAGGCGCTCGCCATCCTTGTCTCCACCT
TCCACCACTCCAAGAGCCCGTCCGCCATCGACCAGACCACATTCGCGCGGTACGTGGAGC
GCACCGCGTTCGAGCGTCCGCTGACGAGCGGGCTGGCGTACGCCGCTCGGGTGACGCACT
CGGAGCGGGAGCTGTTCGAGCGGCAGCAAGCGTGGAGCATCAGAGCGATGAACTTCTCCT
CCAAACGGCCGCGGGCGGAGGAGTACGCCCCGGTCATCTTCGCGCAGGACGCCTACAAGC
ACGTCGTCTCCATCGACATGCTCTCGGGGGCAGAAGACCGTGGAAATCTACTGCGAGCGA
GAGAATCAGGCAAGGTTGTTCTAACTGCTCCTTTCCAGCTGCTCAATAAACGCATCGGAG
TGGTCCTGACGTACGCAGTGTACAAGTCTGAGCTTCCCCTGAATGCGACGGTGCATGATC
GTATACAGTCTTCTATAGGATACTTGGGTGGTGTCTTTGACATAGAAGGACATGTTGATA
AGTTGCTTGAAAAGCTTGCAGGCAAAGAGCCCATGACGGTGAACATATACGACACTACCG
GTGAGAGCATGATTCGTATGTATGGTTCTTCGAATGAATCAGCCAGTGGCATGTGTCATG
TCAGCACGCTCGACTTCGGTGATCCATTAAGGAAGCACGAGATGCATTGCAGGTTCACGC
AAGGGCCACCTTGGCCATGGCTGGCAGTAGCATCATCGTACGGAACCCTCGTGATTTCTT
TACTTGTTGGATACATCTTTCATTTTACTGACAAATGGATTGCCAAAGTCGAAGATGGTT
ACAAGGCGACTGACATGCAGATGCCAGCAAAGGATGAATTCGCGGCCACAGAGAGGATTT
CAGATATGGAAAGAGATCTGAAGGAAGATGCTCTGTTTTTCGACACGACCAAAAGCCCCA
GTCTGTTGGAGATCTCGCGTCTGCTGAACCATCGTGATCCAGCTCAGAATGTTCACCAGG
AGGAGCAAGAGCTCAACCTTCCATTGGAGGCGCAAGACAAACTGAAAGAGACTGAGAGGA
AGCTGGGGAGGATGTCCAAGTTCATTACAAAGGTTATGAAATTAACTAGCGCTAGCATTC
GCTGTTTACCTTCTCGATTTCACTGCTTCAACAAGAAGGTATGGAGCATTAGCCTTCTCG
GATTTTTACTCTTCATTCTTGTCATTGGAGCTTTTGATCAGCCATACAATCAACCTTTGG
GCATGGGAGGGGAGGGTGACAATAACATGATGCTGAAGAATTTTGGGTTCTCTCGTGGAA
GGTTGTTAATTGATACGCTCCATGGTACATGGACTAAACGCGGTGTGCAGAGTAGTGACA
CGATCAGGGTTGATCTCAGAAAGATGACAAGGAATAATGACAGTTCTGGGCAGCAGCTCA
AGCACTGGTCTTCACATAAGTCAAGTGAGATCCCGGCTGTCCTGTATGTTCCGATGAATG
GAAAGCAAGTTATAGTCCACTGCAATCTAATTGTAGATGAGAAAGCATtggtaaattgga
tatcaaatggtgatactgatcagtcaagcaagtatcagaaagaaactgcagggatacaaa
acagaacagacaagcctcacctgccagcaaacaagtcacacaaaacaacagtaagcccgt
ggattgtcttacttccagttatcatgcttgtactccttggcagtattatatggcgccggt
gcaacgaccataggaggagagttcaacaaaaagagctggaacttttgggaataatggggc
ctagtcgattccaactacaagatctggtagccgcaacgggcaatttcgcagatgagaaca
agctcgggcaaggagggtttggccctgtgtacaaaggctacttgagggaccaggaccttc
atgtggccatcaaggtgttgtccagaaggcaatcttgtcaagaacaatcggcgcaagggt
tgagggagttcaaggcagaggtgaaagtcatgacgcaactgaggcacagaaacattgtca
agcttgtgggctggagcgacagcaagaaacagctccttctcgtttatgaacttatggctc
aaggaagccttgacaagcatctctacgaccctgagaaaattttaacttggcaacaaaggt
accaaattaaatttgctaacctgtTTAATTCAACTGacaagattgtacttgatctgggct
ctgctttgctctacctccaccatgactgcgagaaatgcattgtgcatggagacatcaagc
ctgcaaatgtaatgcttgatgtgtcacacaatgctaagcttggtgacttcgggttagcaa
ggcttgttgagcatgggggagagccacaaacaacacaagttgtcgcagggacccctggat
acattgacccagaattcatcaacaaccgctggcctcgcaccgaattggatgtgtacagct
tcggtattgtcctcttagagatagcttgtggcaagcggccggcatcgaggcagctgccaa
atggagcttcatcactgctagcctgggtgcgtgatttgtatgaccagggcaagattcttg
acgcagcagatcagagactgaacggcgagttcaatcagcagcaaatggagcgtgtgatcg
tcatgggtctctgctgttcacatcaagacccgatccagcgaccgtctatcgtgcaagcta
tggatgttctgtgatctgcagacgcagagttgccggtacctcccgcagcacatgatacag
gacacatccggtccatgcaagaacaggcttatgccgacctgccagttgaggatcattctg
tgcatactgtcacccgaagtacgtattttacttccaaggattcagtttatctacttgctg
aAGGATAACGAATTCTCTCTTTTGAATAGCAATATTAGTTATGTTTACATGCGCCTGTTT
AGATTGTTTTGTCAACAAGATTGCTGATAGGCACACATCTATTTTGTTCATAGTTTTGTG
CTATCTATCTATCTATTATCCATCTACACATGTAGTATAAATGATAGTTTCATATGAACC
AGCTCTATTGTTAGCATTAATCCTGACTTAC

CDS

2847 bp

>Os12t0454800-01 Receptor-like serine/threonine kinase, Cytokinin signaling
ATGGCGCTACTGCTCTGGGTGTTCAGCTGCTCGCTCTTCTCCTTGTGGATCCTCTCGTTC
ATGAGGTCCCAGGCCACCGAGGCGCGCCACGGGACGCTCGCCGTCATGTGCGACGAGCGC
GCCCGGATCCTCCAGGACCAGGTGAAGGTGAGCATGAACCACCTCCAGGCGCTCGCCATC
CTTGTCTCCACCTTCCACCACTCCAAGAGCCCGTCCGCCATCGACCAGACCACATTCGCG
CGGTACGTGGAGCGCACCGCGTTCGAGCGTCCGCTGACGAGCGGGCTGGCGTACGCCGCT
CGGGTGACGCACTCGGAGCGGGAGCTGTTCGAGCGGCAGCAAGCGTGGAGCATCAGAGCG
ATGAACTTCTCCTCCAAACGGCCGCGGGCGGAGGAGTACGCCCCGGTCATCTTCGCGCAG
GACGCCTACAAGCACGTCGTCTCCATCGACATGCTCTCGGGGGCAGAAGACCGTGGAAAT
CTACTGCGAGCGAGAGAATCAGGCAAGGTTGTTCTAACTGCTCCTTTCCAGCTGCTCAAT
AAACGCATCGGAGTGGTCCTGACGTACGCAGTGTACAAGTCTGAGCTTCCCCTGAATGCG
ACGGTGCATGATCGTATACAGTCTTCTATAGGATACTTGGGTGGTGTCTTTGACATAGAA
GGACATGTTGATAAGTTGCTTGAAAAGCTTGCAGGCAAAGAGCCCATGACGGTGAACATA
TACGACACTACCGGTGAGAGCATGATTCGTATGTATGGTTCTTCGAATGAATCAGCCAGT
GGCATGTGTCATGTCAGCACGCTCGACTTCGGTGATCCATTAAGGAAGCACGAGATGCAT
TGCAGGTTCACGCAAGGGCCACCTTGGCCATGGCTGGCAGTAGCATCATCGTACGGAACC
CTCGTGATTTCTTTACTTGTTGGATACATCTTTCATTTTACTGACAAATGGATTGCCAAA
GTCGAAGATGGTTACAAGGCGACTGACATGCAGATGCCAGCAAAGGATGAATTCGCGGCC
ACAGAGAGGATTTCAGATATGGAAAGAGATCTGAAGGAAGATGCTCTGTTTTTCGACACG
ACCAAAAGCCCCAGTCTGTTGGAGATCTCGCGTCTGCTGAACCATCGTGATCCAGCTCAG
AATGTTCACCAGGAGGAGCAAGAGCTCAACCTTCCATTGGAGGCGCAAGACAAACTGAAA
GAGACTGAGAGGAAGCTGGGGAGGATGTCCAAGTTCATTACAAAGGTTATGAAATTAACT
AGCGCTAGCATTCGCTGTTTACCTTCTCGATTTCACTGCTTCAACAAGAAGGTATGGAGC
ATTAGCCTTCTCGGATTTTTACTCTTCATTCTTGTCATTGGAGCTTTTGATCAGCCATAC
AATCAACCTTTGGGCATGGGAGGGGAGGGTGACAATAACATGATGCTGAAGAATTTTGGG
TTCTCTCGTGGAAGGTTGTTAATTGATACGCTCCATGGTACATGGACTAAACGCGGTGTG
CAGAGTAGTGACACGATCAGGGTTGATCTCAGAAAGATGACAAGGAATAATGACAGTTCT
GGGCAGCAGCTCAAGCACTGGTCTTCACATAAGTCAAGTGAGATCCCGGCTGTCCTGTAT
GTTCCGATGAATGGAAAGCAAGTTATAGTCCACTGCAATCTAATTGTAGATGAGAAAGCA
Ttggtaaattggatatcaaatggtgatactgatcagtcaagcaagtatcagaaagaaact
gcagggatacaaaacagaacagacaagcctcacctgccagcaaacaagtcacacaaaaca
acagtaagcccgtggattgtcttacttccagttatcatgcttgtactccttggcagtatt
atatggcgccggtgcaacgaccataggaggagagttcaacaaaaagagctggaacttttg
ggaataatggggcctagtcgattccaactacaagatctggtagccgcaacgggcaatttc
gcagatgagaacaagctcgggcaaggagggtttggccctgtgtacaaaggctacttgagg
gaccaggaccttcatgtggccatcaaggtgttgtccagaaggcaatcttgtcaagaacaa
tcggcgcaagggttgagggagttcaaggcagaggtgaaagtcatgacgcaactgaggcac
agaaacattgtcaagcttgtgggctggagcgacagcaagaaacagctccttctcgtttat
gaacttatggctcaaggaagccttgacaagcatctctacgaccctgagaaaattttaact
tggcaacaaaggtaccaaattaaatttgctaacctgtTTAATTCAACTGacaagattgta
cttgatctgggctctgctttgctctacctccaccatgactgcgagaaatgcattgtgcat
ggagacatcaagcctgcaaatgtaatgcttgatgtgtcacacaatgctaagcttggtgac
ttcgggttagcaaggcttgttgagcatgggggagagccacaaacaacacaagttgtcgca
gggacccctggatacattgacccagaattcatcaacaaccgctggcctcgcaccgaattg
gatgtgtacagcttcggtattgtcctcttagagatagcttgtggcaagcggccggcatcg
aggcagctgccaaatggagcttcatcactgctagcctgggtgcgtgatttgtatgaccag
ggcaagattcttgacgcagcagatcagagactgaacggcgagttcaatcagcagcaaatg
gagcgtgtgatcgtcatgggtctctgctgttcacatcaagacccgatccagcgaccgtct
atcgtgcaagctatggatgttctgtga

Protein

949 aa

>Os12t0454800-01 Receptor-like serine/threonine kinase, Cytokinin signaling
MALLLWVFSCSLFSLWILSFMRSQATEARHGTLAVMCDERARILQDQVKVSMNHLQALAI
LVSTFHHSKSPSAIDQTTFARYVERTAFERPLTSGLAYAARVTHSERELFERQQAWSIRA
MNFSSKRPRAEEYAPVIFAQDAYKHVVSIDMLSGAEDRGNLLRARESGKVVLTAPFQLLN
KRIGVVLTYAVYKSELPLNATVHDRIQSSIGYLGGVFDIEGHVDKLLEKLAGKEPMTVNI
YDTTGESMIRMYGSSNESASGMCHVSTLDFGDPLRKHEMHCRFTQGPPWPWLAVASSYGT
LVISLLVGYIFHFTDKWIAKVEDGYKATDMQMPAKDEFAATERISDMERDLKEDALFFDT
TKSPSLLEISRLLNHRDPAQNVHQEEQELNLPLEAQDKLKETERKLGRMSKFITKVMKLT
SASIRCLPSRFHCFNKKVWSISLLGFLLFILVIGAFDQPYNQPLGMGGEGDNNMMLKNFG
FSRGRLLIDTLHGTWTKRGVQSSDTIRVDLRKMTRNNDSSGQQLKHWSSHKSSEIPAVLY
VPMNGKQVIVHCNLIVDEKALVNWISNGDTDQSSKYQKETAGIQNRTDKPHLPANKSHKT
TVSPWIVLLPVIMLVLLGSIIWRRCNDHRRRVQQKELELLGIMGPSRFQLQDLVAATGNF
ADENKLGQGGFGPVYKGYLRDQDLHVAIKVLSRRQSCQEQSAQGLREFKAEVKVMTQLRH
RNIVKLVGWSDSKKQLLLVYELMAQGSLDKHLYDPEKILTWQQRYQIKFANLFNSTDKIV
LDLGSALLYLHHDCEKCIVHGDIKPANVMLDVSHNAKLGDFGLARLVEHGGEPQTTQVVA
GTPGYIDPEFINNRWPRTELDVYSFGIVLLEIACGKRPASRQLPNGASSLLAWVRDLYDQ
GKILDAADQRLNGEFNQQQMERVIVMGLCCSHQDPIQRPSIVQAMDVL*

5'UTR

chr12:15776462..15776688 (+ strand) : 227 bp

CDS

chr12:15776689..15779535 (+ strand) : 2847 bp

3'UTR

chr12:15779536..15779912 (+ strand) : 377 bp

FASTA

>Os12t0454800-01 class=Sequence position=chr12:15776462..15779912 (+ strand)
GTTGATCGCG CGGACGACAC CCCCATGTCG TGGACGCAGA GCGCTAAGGA CGGCTGCCGC AGCCGAGCCA AGGCATCAGC
GGATCGAGCG CGATTCTGCT CTGCGGGGAG CCCCGACGAC TGGGGCGGGG TTGGAGGAGG AGAACAGCAC GGCTGCCTGG
CTTGCCTGGT TGTGGCTGCT GCTGCTACCG TTGAAGCTGT CGGTTCACCG GCAGCGCCTG CCACTGGATG GCGCTACTGC
TCTGGGTGTT CAGCTGCTCG CTCTTCTCCT TGTGGATCCT CTCGTTCATG AGGTCCCAGG CCACCGAGGC GCGCCACGGG
ACGCTCGCCG TCATGTGCGA CGAGCGCGCC CGGATCCTCC AGGACCAGGT GAAGGTGAGC ATGAACCACC TCCAGGCGCT
CGCCATCCTT GTCTCCACCT TCCACCACTC CAAGAGCCCG TCCGCCATCG ACCAGACCAC ATTCGCGCGG TACGTGGAGC
GCACCGCGTT CGAGCGTCCG CTGACGAGCG GGCTGGCGTA CGCCGCTCGG GTGACGCACT CGGAGCGGGA GCTGTTCGAG
CGGCAGCAAG CGTGGAGCAT CAGAGCGATG AACTTCTCCT CCAAACGGCC GCGGGCGGAG GAGTACGCCC CGGTCATCTT
CGCGCAGGAC GCCTACAAGC ACGTCGTCTC CATCGACATG CTCTCGGGGG CAGAAGACCG TGGAAATCTA CTGCGAGCGA
GAGAATCAGG CAAGGTTGTT CTAACTGCTC CTTTCCAGCT GCTCAATAAA CGCATCGGAG TGGTCCTGAC GTACGCAGTG
TACAAGTCTG AGCTTCCCCT GAATGCGACG GTGCATGATC GTATACAGTC TTCTATAGGA TACTTGGGTG GTGTCTTTGA
CATAGAAGGA CATGTTGATA AGTTGCTTGA AAAGCTTGCA GGCAAAGAGC CCATGACGGT GAACATATAC GACACTACCG
GTGAGAGCAT GATTCGTATG TATGGTTCTT CGAATGAATC AGCCAGTGGC ATGTGTCATG TCAGCACGCT CGACTTCGGT
GATCCATTAA GGAAGCACGA GATGCATTGC AGGTTCACGC AAGGGCCACC TTGGCCATGG CTGGCAGTAG CATCATCGTA
CGGAACCCTC GTGATTTCTT TACTTGTTGG ATACATCTTT CATTTTACTG ACAAATGGAT TGCCAAAGTC GAAGATGGTT
ACAAGGCGAC TGACATGCAG ATGCCAGCAA AGGATGAATT CGCGGCCACA GAGAGGATTT CAGATATGGA AAGAGATCTG
AAGGAAGATG CTCTGTTTTT CGACACGACC AAAAGCCCCA GTCTGTTGGA GATCTCGCGT CTGCTGAACC ATCGTGATCC
AGCTCAGAAT GTTCACCAGG AGGAGCAAGA GCTCAACCTT CCATTGGAGG CGCAAGACAA ACTGAAAGAG ACTGAGAGGA
AGCTGGGGAG GATGTCCAAG TTCATTACAA AGGTTATGAA ATTAACTAGC GCTAGCATTC GCTGTTTACC TTCTCGATTT
CACTGCTTCA ACAAGAAGGT ATGGAGCATT AGCCTTCTCG GATTTTTACT CTTCATTCTT GTCATTGGAG CTTTTGATCA
GCCATACAAT CAACCTTTGG GCATGGGAGG GGAGGGTGAC AATAACATGA TGCTGAAGAA TTTTGGGTTC TCTCGTGGAA
GGTTGTTAAT TGATACGCTC CATGGTACAT GGACTAAACG CGGTGTGCAG AGTAGTGACA CGATCAGGGT TGATCTCAGA
AAGATGACAA GGAATAATGA CAGTTCTGGG CAGCAGCTCA AGCACTGGTC TTCACATAAG TCAAGTGAGA TCCCGGCTGT
CCTGTATGTT CCGATGAATG GAAAGCAAGT TATAGTCCAC TGCAATCTAA TTGTAGATGA GAAAGCATtg gtaaattgga
tatcaaatgg tgatactgat cagtcaagca agtatcagaa agaaactgca gggatacaaa acagaacaga caagcctcac
ctgccagcaa acaagtcaca caaaacaaca gtaagcccgt ggattgtctt acttccagtt atcatgcttg tactccttgg
cagtattata tggcgccggt gcaacgacca taggaggaga gttcaacaaa aagagctgga acttttggga ataatggggc
ctagtcgatt ccaactacaa gatctggtag ccgcaacggg caatttcgca gatgagaaca agctcgggca aggagggttt
ggccctgtgt acaaaggcta cttgagggac caggaccttc atgtggccat caaggtgttg tccagaaggc aatcttgtca
agaacaatcg gcgcaagggt tgagggagtt caaggcagag gtgaaagtca tgacgcaact gaggcacaga aacattgtca
agcttgtggg ctggagcgac agcaagaaac agctccttct cgtttatgaa cttatggctc aaggaagcct tgacaagcat
ctctacgacc ctgagaaaat tttaacttgg caacaaaggt accaaattaa atttgctaac ctgtTTAATT CAACTGacaa
gattgtactt gatctgggct ctgctttgct ctacctccac catgactgcg agaaatgcat tgtgcatgga gacatcaagc
ctgcaaatgt aatgcttgat gtgtcacaca atgctaagct tggtgacttc gggttagcaa ggcttgttga gcatggggga
gagccacaaa caacacaagt tgtcgcaggg acccctggat acattgaccc agaattcatc aacaaccgct ggcctcgcac
cgaattggat gtgtacagct tcggtattgt cctcttagag atagcttgtg gcaagcggcc ggcatcgagg cagctgccaa
atggagcttc atcactgcta gcctgggtgc gtgatttgta tgaccagggc aagattcttg acgcagcaga tcagagactg
aacggcgagt tcaatcagca gcaaatggag cgtgtgatcg tcatgggtct ctgctgttca catcaagacc cgatccagcg
accgtctatc gtgcaagcta tggatgttct gtgatctgca gacgcagagt tgccggtacc tcccgcagca catgatacag
gacacatccg gtccatgcaa gaacaggctt atgccgacct gccagttgag gatcattctg tgcatactgt cacccgaagt
acgtatttta cttccaagga ttcagtttat ctacttgctg aAGGATAACG AATTCTCTCT TTTGAATAGC AATATTAGTT
ATGTTTACAT GCGCCTGTTT AGATTGTTTT GTCAACAAGA TTGCTGATAG GCACACATCT ATTTTGTTCA TAGTTTTGTG
CTATCTATCT ATCTATTATC CATCTACACA TGTAGTATAA ATGATAGTTT CATATGAACC AGCTCTATTG TTAGCATTAA
TCCTGACTTA C

Locus: Os12g0454800

Loading...

Locus: Os12g0454800

Loading...