Os12t0468500-01

Locus

Os12g0468500

Description

Similar to predicted protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CNGC17

CGSNL Gene Name

CYCLIC NUCLEOTIDE GATED CHANNEL 17

Oryzabase Gene Symbol Synonym(s)

OsCNGC17, OsCNGC5, OsSTA282

Oryzabase Gene Name Synonym(s)

Cyclic nucleotide gated channel 17, Cyclic nucleotide-gated ion channel 5

Transcript Evidence

AK240644 (DDBJ, Best hit)

Protein Evidence

NP_173051.1 (RefSeq)

Literature

Note

Manual Curation

Gene Ontology (GO)

Biological Process: ion transport (GO:0006811)

Biological Process: potassium ion transport (GO:0006813)

Biological Process: transmembrane transport (GO:0055085)

Cellular Component: membrane (GO:0016020)

Molecular Function: ion channel activity (GO:0005216)

Molecular Function: voltage-gated potassium channel activity (GO:0005249)

Molecular Function: protein binding (GO:0005515)

Functional domain (InterPro)

IQ motif, EF-hand binding site (IPR000048)

Cyclic nucleotide-binding domain (IPR000595)

Potassium channel, voltage-dependent, EAG/ELK/ERG (IPR003938)

Ion transport (IPR005821)

RmlC-like jelly roll fold (IPR014710)

Cyclic nucleotide-binding-like (IPR018490)

Expression Databases

TENOR (Os12t0468500-01)

Others

Oryzabase (15490)

KEGG (Os12t0468500-01)

Transcript

3087 bp

>Os12t0468500-01 Similar to predicted protein.
GTGTTTCTGATCGAGAAGAATGCTTCTGACAAATCGATCCCTCTGAAATTTCGTTGGTCA
GAGATCAATCGATTCTTCAAGAAGGAATCGCAAATCGCAATGCATGCATGAGGAAGCAAT
TGCATCGATCGATGTCATCAGCAATGGCGGCGGCAAAGGAGGCAGCAGGTGAGGAGGCGT
CGTAAGATGTTTGGCAGCTGCGGCGGCGGGTACAGGACGCAGACGATCAACGGGAGGAAG
GGGACGTTCGTGCGGCTCGAGCAGCAGGAGGATCAGGAGCGGCAGCCGGCGGCGACGTAC
ACCATGGACGGCAGCGGCGGCGGCGGCAGGGTGCAGCACGTGATGGACAGCTACTTCTCG
AGCGCGCCCAAGATCCGGACGCGGTCGGTGCGCATGGCGGCGGCGGGCGTGATGAGCATC
GGCGGCTACCGGGCGGAGCGGCTCAAGAGCATCGGCCGCGTGTTCCAGGAGGACCTCACC
AACATGTCCCAGAAGATCTTCGACCCGCAGGACGCGTTCCTGGTGCGGATGAACCGCCTC
TTCGTCATGGCCTGCATCGTCTCCGTCGCCGTCGACCCACTCTTCTTCTACCTCCCCGCC
GTCACCGCCACCGACAGCAACACCTGCATCGGCTTCGACCGCGGCCTCGCCACGGGCGCC
ACCGCGGTGCGCTCGGCCATCGACCTCTTCTACCTCGCCCGCATCGCGCTCCAGTTCCGG
ACGGCGTACATCGCGCCGTCGTCGCGGGTGTTCGGCCGCGGCGAGCTGGTGATCGACCCG
GCCGCCATCGCGCGGCGCTACGTCCGCCGCTTCTTCGTCGTCGACCTCCTCTCCGTGCTC
CCGCTGCCGCAGATCCCCATCTGGAACTTCCTCCACCGCCCCAAGGGCGCCGACCTCCTG
CCCACCAAGAACGCCCTCCTCTTCATCGTCCTCGTCCAGTACATCCCCCGCCTCGTCCGC
TTCTACCCCATCACCTCCGAGCTCAAGCGCACCACCGGCGTCTTCGCCGAGACCGCCTTC
GCCGGCGCCGCCTACTACCTCCTCCTCTACATGCTCGCCAGCCACATGGTGGGGGCGTTC
TGGTACCTGCTATCGATCGAGAGGCTGGACGACTGCTGGAGGGAGAACTGCAGGGTGCTC
AAGTTCCATCAGTGCAAGAAGTACATGTACTGCGGAGGAGGGAACCTGGGGCAGTCGGGT
TTCCTGGAGTGGAGGACGATGATCCGGCAGGTGCTGGTGATGGAGTGCGCGCCGGCGGAC
GAGGCCGGGACCGGGTTCCAGTACGGGATCTTCACGACGGCGATCCAGTCGGGCGTGGTG
TCGACGACGAACCTGGTCGCCAAGGTGCTCTTCTGCCTCTGGTGGGGGCTCCAGAACCTG
AGCACCGTGGGGCAGGGGCTGAAGACGACGCACTACAAGGGGGAGGCCCTGTTCGCCATC
TTCCTCGCCGTGTTCGGCCTCATCCTCATGGCGCTCCTCATCGGCAACATGCAGACGTAC
CTGCAGTCGATGACGCTGCGGCTTGAGGAGATGCGGCTGCGGCGCCGCGACTCGGAGCAG
TGGATGCGCCACCGCGTGCTCCCCGTCGACCTCCAGGAGCGCGTGTGGCGGCACGACCAG
TACCGGTGGCTGGAGACGCGGGGCGTGGACGAGGACAGCCTCGTGCGCAGCCTCCCCAAG
GACCTGCGGCGGGACGTGAAGCGGCACCTCTGCCTCCGCCTCGTCCGCCGCGTGCCGCTG
TTCGCCAACATGGACGAGCGCCTCCTCGACGCCATCTGCGAGCGCCTCAAGCCCAGCCTG
TGCACGGAGGCCACCTACATCCTCCGGGAAGGGGACCCCGTGGACGAGATGCTGTTCATC
ATCCGCGGGAGGCTGGAGAGCTCCACCACGGACGGCGGGAGGATGGGGTTCTTCAACCGG
GGCCTCCTCAAGGAAGGGGACTTCTGCGGGGAGGAGCTCCTGACGTGGGCGCTCGACCCC
AAGGCCGCCGCCAACCTGCCGCTGTCGACGCGCACCGTCAAGGCCATCTCCGAGGTGGAG
GCGTTCGCGCTCCACGCCGACGAGCTCAAGTTCGTCGCCGGGCAGTTCAGGCGGCTGCAC
AGCAAGCAGCTGCAGCAGACGTTCCGGTTCTACTCGCAGCAGTGGCGCACCTGGGCGTCC
TGCTTCATCCAGGCCGCCTGGAGGAGGCACCTCAAGCGCAGGGCCGCCGAGCAGCGCCGC
CGCGAGGAGGAGGAGGAGGAGGAGGCCGCGTCGGCGTCGTCGTCCTGCCAGATCACCACC
ACCGTCCTCGTATCGCGCTTCGCCAAGAACGCCATGCGCGGCGCGCAGCGGCAACGGTCG
CGCCGGGACGCCAACCTCATCGTCCTGCCCAAACCGCCGGAGCCTGACTTCCAGACCATG
GAGTACTGATTGGTAGTGTCGAATTATACACAACATGCAAATCTTGATGGAGAGGAAACC
AATTATACTTTTGTCAGTCTGGCTGTACCGCTGGGGGGATTTGCAATTATAACACTGCTG
CAGCAAATTTCTTATTTACTTTACATGTTGAGGTACCACCACCCCTGGCCAGGAGATTAT
CATACAATCCGTGCAGAATACTGGACAGATTCAAGCAGTGGCACATGAACAAAATGCAAG
ACGATCATCACAAATTCACAAGTAGTTCATCCGATTGGGTAGGTTGATGCCAGCTCGCGC
TAGAAGGTCCCTTGCTATTTTTTCAGCTGAAGCAATTACCTCCTCCTGGAATAGACCACA
GGAAAAGTAAAAAACAGAGCCACAGAGGCCAGAGTGTGAGAGACACAATCAGTTTTCAGT
GCATTATAGGTACTTAAGCAGGGTGTAAAATTATTGGTTGGTGAACCAGACAATTATATA
CCAAAGCCTATTTTTAGCATATGGTCAGCTAGGGGTAGGACTGTTGGAGTACCGTTTCTA
CTTTCTAACCATTAGAAATCTGAACTTCAGAAGTGTTTATTCCTCATGAATGTTTTGACA
TTACCTGTTCTAGTTTAACCAGTTCGTGAATTGTTGGCATGCAATTATGTTCATCGTGTT
TACTGTTTAATCTAGCATATTTGGCTC

CDS

2223 bp

>Os12t0468500-01 Similar to predicted protein.
ATGTTTGGCAGCTGCGGCGGCGGGTACAGGACGCAGACGATCAACGGGAGGAAGGGGACG
TTCGTGCGGCTCGAGCAGCAGGAGGATCAGGAGCGGCAGCCGGCGGCGACGTACACCATG
GACGGCAGCGGCGGCGGCGGCAGGGTGCAGCACGTGATGGACAGCTACTTCTCGAGCGCG
CCCAAGATCCGGACGCGGTCGGTGCGCATGGCGGCGGCGGGCGTGATGAGCATCGGCGGC
TACCGGGCGGAGCGGCTCAAGAGCATCGGCCGCGTGTTCCAGGAGGACCTCACCAACATG
TCCCAGAAGATCTTCGACCCGCAGGACGCGTTCCTGGTGCGGATGAACCGCCTCTTCGTC
ATGGCCTGCATCGTCTCCGTCGCCGTCGACCCACTCTTCTTCTACCTCCCCGCCGTCACC
GCCACCGACAGCAACACCTGCATCGGCTTCGACCGCGGCCTCGCCACGGGCGCCACCGCG
GTGCGCTCGGCCATCGACCTCTTCTACCTCGCCCGCATCGCGCTCCAGTTCCGGACGGCG
TACATCGCGCCGTCGTCGCGGGTGTTCGGCCGCGGCGAGCTGGTGATCGACCCGGCCGCC
ATCGCGCGGCGCTACGTCCGCCGCTTCTTCGTCGTCGACCTCCTCTCCGTGCTCCCGCTG
CCGCAGATCCCCATCTGGAACTTCCTCCACCGCCCCAAGGGCGCCGACCTCCTGCCCACC
AAGAACGCCCTCCTCTTCATCGTCCTCGTCCAGTACATCCCCCGCCTCGTCCGCTTCTAC
CCCATCACCTCCGAGCTCAAGCGCACCACCGGCGTCTTCGCCGAGACCGCCTTCGCCGGC
GCCGCCTACTACCTCCTCCTCTACATGCTCGCCAGCCACATGGTGGGGGCGTTCTGGTAC
CTGCTATCGATCGAGAGGCTGGACGACTGCTGGAGGGAGAACTGCAGGGTGCTCAAGTTC
CATCAGTGCAAGAAGTACATGTACTGCGGAGGAGGGAACCTGGGGCAGTCGGGTTTCCTG
GAGTGGAGGACGATGATCCGGCAGGTGCTGGTGATGGAGTGCGCGCCGGCGGACGAGGCC
GGGACCGGGTTCCAGTACGGGATCTTCACGACGGCGATCCAGTCGGGCGTGGTGTCGACG
ACGAACCTGGTCGCCAAGGTGCTCTTCTGCCTCTGGTGGGGGCTCCAGAACCTGAGCACC
GTGGGGCAGGGGCTGAAGACGACGCACTACAAGGGGGAGGCCCTGTTCGCCATCTTCCTC
GCCGTGTTCGGCCTCATCCTCATGGCGCTCCTCATCGGCAACATGCAGACGTACCTGCAG
TCGATGACGCTGCGGCTTGAGGAGATGCGGCTGCGGCGCCGCGACTCGGAGCAGTGGATG
CGCCACCGCGTGCTCCCCGTCGACCTCCAGGAGCGCGTGTGGCGGCACGACCAGTACCGG
TGGCTGGAGACGCGGGGCGTGGACGAGGACAGCCTCGTGCGCAGCCTCCCCAAGGACCTG
CGGCGGGACGTGAAGCGGCACCTCTGCCTCCGCCTCGTCCGCCGCGTGCCGCTGTTCGCC
AACATGGACGAGCGCCTCCTCGACGCCATCTGCGAGCGCCTCAAGCCCAGCCTGTGCACG
GAGGCCACCTACATCCTCCGGGAAGGGGACCCCGTGGACGAGATGCTGTTCATCATCCGC
GGGAGGCTGGAGAGCTCCACCACGGACGGCGGGAGGATGGGGTTCTTCAACCGGGGCCTC
CTCAAGGAAGGGGACTTCTGCGGGGAGGAGCTCCTGACGTGGGCGCTCGACCCCAAGGCC
GCCGCCAACCTGCCGCTGTCGACGCGCACCGTCAAGGCCATCTCCGAGGTGGAGGCGTTC
GCGCTCCACGCCGACGAGCTCAAGTTCGTCGCCGGGCAGTTCAGGCGGCTGCACAGCAAG
CAGCTGCAGCAGACGTTCCGGTTCTACTCGCAGCAGTGGCGCACCTGGGCGTCCTGCTTC
ATCCAGGCCGCCTGGAGGAGGCACCTCAAGCGCAGGGCCGCCGAGCAGCGCCGCCGCGAG
GAGGAGGAGGAGGAGGAGGCCGCGTCGGCGTCGTCGTCCTGCCAGATCACCACCACCGTC
CTCGTATCGCGCTTCGCCAAGAACGCCATGCGCGGCGCGCAGCGGCAACGGTCGCGCCGG
GACGCCAACCTCATCGTCCTGCCCAAACCGCCGGAGCCTGACTTCCAGACCATGGAGTAC
TGA

Protein

741 aa

>Os12t0468500-01 Similar to predicted protein.
MFGSCGGGYRTQTINGRKGTFVRLEQQEDQERQPAATYTMDGSGGGGRVQHVMDSYFSSA
PKIRTRSVRMAAAGVMSIGGYRAERLKSIGRVFQEDLTNMSQKIFDPQDAFLVRMNRLFV
MACIVSVAVDPLFFYLPAVTATDSNTCIGFDRGLATGATAVRSAIDLFYLARIALQFRTA
YIAPSSRVFGRGELVIDPAAIARRYVRRFFVVDLLSVLPLPQIPIWNFLHRPKGADLLPT
KNALLFIVLVQYIPRLVRFYPITSELKRTTGVFAETAFAGAAYYLLLYMLASHMVGAFWY
LLSIERLDDCWRENCRVLKFHQCKKYMYCGGGNLGQSGFLEWRTMIRQVLVMECAPADEA
GTGFQYGIFTTAIQSGVVSTTNLVAKVLFCLWWGLQNLSTVGQGLKTTHYKGEALFAIFL
AVFGLILMALLIGNMQTYLQSMTLRLEEMRLRRRDSEQWMRHRVLPVDLQERVWRHDQYR
WLETRGVDEDSLVRSLPKDLRRDVKRHLCLRLVRRVPLFANMDERLLDAICERLKPSLCT
EATYILREGDPVDEMLFIIRGRLESSTTDGGRMGFFNRGLLKEGDFCGEELLTWALDPKA
AANLPLSTRTVKAISEVEAFALHADELKFVAGQFRRLHSKQLQQTFRFYSQQWRTWASCF
IQAAWRRHLKRRAAEQRRREEEEEEEAASASSSCQITTTVLVSRFAKNAMRGAQRQRSRR
DANLIVLPKPPEPDFQTMEY*

5'UTR

chr12:16702529..16702714 (+ strand) : 186 bp

CDS

chr12:16702715..16703593 (+ strand) : 879 bp

chr12:16704177..16704707 (+ strand) : 531 bp

chr12:16705719..16706531 (+ strand) : 813 bp

3'UTR

chr12:16706532..16707209 (+ strand) : 678 bp

FASTA

>Os12t0468500-01 class=Sequence position=chr12:16702529..16707209 (+ strand)
GTGTTTCTGA TCGAGAAGAA TGCTTCTGAC AAATCGATCC CTCTGAAATT TCGTTGGTCA GAGATCAATC GATTCTTCAA
GAAGGAATCG CAAATCGCAA TGCATGCATG AGGAAGCAAT TGCATCGATC GATGTCATCA GCAATGGCGG CGGCAAAGGA
GGCAGCAGGT GAGGAGGCGT CGTAAGATGT TTGGCAGCTG CGGCGGCGGG TACAGGACGC AGACGATCAA CGGGAGGAAG
GGGACGTTCG TGCGGCTCGA GCAGCAGGAG GATCAGGAGC GGCAGCCGGC GGCGACGTAC ACCATGGACG GCAGCGGCGG
CGGCGGCAGG GTGCAGCACG TGATGGACAG CTACTTCTCG AGCGCGCCCA AGATCCGGAC GCGGTCGGTG CGCATGGCGG
CGGCGGGCGT GATGAGCATC GGCGGCTACC GGGCGGAGCG GCTCAAGAGC ATCGGCCGCG TGTTCCAGGA GGACCTCACC
AACATGTCCC AGAAGATCTT CGACCCGCAG GACGCGTTCC TGGTGCGGAT GAACCGCCTC TTCGTCATGG CCTGCATCGT
CTCCGTCGCC GTCGACCCAC TCTTCTTCTA CCTCCCCGCC GTCACCGCCA CCGACAGCAA CACCTGCATC GGCTTCGACC
GCGGCCTCGC CACGGGCGCC ACCGCGGTGC GCTCGGCCAT CGACCTCTTC TACCTCGCCC GCATCGCGCT CCAGTTCCGG
ACGGCGTACA TCGCGCCGTC GTCGCGGGTG TTCGGCCGCG GCGAGCTGGT GATCGACCCG GCCGCCATCG CGCGGCGCTA
CGTCCGCCGC TTCTTCGTCG TCGACCTCCT CTCCGTGCTC CCGCTGCCGC AGATCCCCAT CTGGAACTTC CTCCACCGCC
CCAAGGGCGC CGACCTCCTG CCCACCAAGA ACGCCCTCCT CTTCATCGTC CTCGTCCAGT ACATCCCCCG CCTCGTCCGC
TTCTACCCCA TCACCTCCGA GCTCAAGCGC ACCACCGGCG TCTTCGCCGA GACCGCCTTC GCCGGCGCCG CCTACTACCT
CCTCCTCTAC ATGCTCGCCA GCCACGTACG TCCACTAATC TTCTCATTCG ATTTgtaaat ttcacataac gtaagtacct
tcaagtttca gaaaacaaca cacgtttcga tacttggcat ttaaCCagtg ttagaaattc cggaatgaaa ttttcgaaat
ttcggacccc ccgatacgat attatttcgg ccaaaatttt taattttttt aatttggtaa tattttgttc aaatttgacc
aacatttgtt taaaattata aaaatttCGG TATATCAGTA ACCACCGATA GAATAAGCCa aaacaaaata tatattaagc
cctgcaatta actacatatg tttttggatt aaagcttcac aaaatcaaac tatcaacgaa ttgaacgacg tgcgagatga
cgaggttgtt ccacgtccag cgcacacatc ctaaatatat atagataaaa aaaaccacgt tatctcgcca ttgcacatgt
tcgttgatag tgtgattttg taaacatcag taacaaaata tatgtaggta agtgttaaaa tatgtatggt tttctatatt
gaaccaATTT ACTTGTGATA TAACAATTGA TACTACAATT TCGATTAGAT GGTGGGGGCG TTCTGGTACC TGCTATCGAT
CGAGAGGCTG GACGACTGCT GGAGGGAGAA CTGCAGGGTG CTCAAGTTCC ATCAGTGCAA GAAGTACATG TACTGCGGAG
GAGGGAACCT GGGGCAGTCG GGTTTCCTGG AGTGGAGGAC GATGATCCGG CAGGTGCTGG TGATGGAGTG CGCGCCGGCG
GACGAGGCCG GGACCGGGTT CCAGTACGGG ATCTTCACGA CGGCGATCCA GTCGGGCGTG GTGTCGACGA CGAACCTGGT
CGCCAAGGTG CTCTTCTGCC TCTGGTGGGG GCTCCAGAAC CTGAGCACCG TGGGGCAGGG GCTGAAGACG ACGCACTACA
AGGGGGAGGC CCTGTTCGCC ATCTTCCTCG CCGTGTTCGG CCTCATCCTC ATGGCGCTCC TCATCGGCAA CATGCAGACG
TACCTGCAGT CGATGACGCT GCGGCTTGAG GAGATGCGGC TGCGGCGCCG CGACTCGGAG CAGTGGATGC GCCACCGCGT
GCTCCCCGTC GACCTCCAGG TATgcaagtg ggttatttta gcccgctaat tatctcactt ctagtatatt ttttcttcta
tactacattc gtcccatatt atttgtcgtt tttgacttat aatgtttgac catttatttt atttgaaaaa ttagtgtaaa
tataaaaaag ataagtcata attaaagtac atttgataat aaaacaagtc acaaataaaa taaataataa ttccaaattt
ttttgaataa gacgaatgat caaatattac aaataaaaac tcaaaacgac aagtaatatg ggacggaggt agtaTTTTGT
ACTACCATGT GAAAAATGAA ATAGCAAATG GTCAAACATT ATAAGTCAAA AACGACAAAT aatataaaaa agataagtca
taattaaagt acatttgata ataaaacaag tcataaataa aataaataat aattctaaat ttttttaata agacaaatga
tcaaacatta caaataaaaa cttaaaacga caagtaatat gggacggagg tagtaTTTTG TACTACCATG TGAAAAATGA
ACGGTTTTGC TAAATTTATA TCGACACATA TTTGCCCTGG TTACAGTCGA TTTTCGAGCC GCTTGATTCT CTGTGAGATC
CGTATAGGAG CAGCGTAAAT ACGAACCGAT TCTGCTGGAA CACTGGCAAT TAAAACCAAC GACCCTAGCC AACTAGTCAC
CTGTGTTTTT CTGTTTGCAA TTATATATTT ATTCAAATTT ATACGGTGCT TACACACCAC TTATATATAT AATTGGTATG
TAAttttaga atttacatat gtaactttaa gatttacata tgtaattttg agacttacat tataaataca ctaaaattac
atatgtaatt tagagacttt taatgtaaat acatgccgac tattttttag tgaaaaatat ggcgccataa atatagctac
tCCCATGATG AAAtagtaag cggattttta taccggtagc cgaactaccc acttgcatcc ctaCCTCCAG GAGCGCGTGT
GGCGGCACGA CCAGTACCGG TGGCTGGAGA CGCGGGGCGT GGACGAGGAC AGCCTCGTGC GCAGCCTCCC CAAGGACCTG
CGGCGGGACG TGAAGCGGCA CCTCTGCCTC CGCCTCGTCC GCCGCGTGCC GCTGTTCGCC AACATGGACG AGCGCCTCCT
CGACGCCATC TGCGAGCGCC TCAAGCCCAG CCTGTGCACG GAGGCCACCT ACATCCTCCG GGAAGGGGAC CCCGTGGACG
AGATGCTGTT CATCATCCGC GGGAGGCTGG AGAGCTCCAC CACGGACGGC GGGAGGATGG GGTTCTTCAA CCGGGGCCTC
CTCAAGGAAG GGGACTTCTG CGGGGAGGAG CTCCTGACGT GGGCGCTCGA CCCCAAGGCC GCCGCCAACC TGCCGCTGTC
GACGCGCACC GTCAAGGCCA TCTCCGAGGT GGAGGCGTTC GCGCTCCACG CCGACGAGCT CAAGTTCGTC GCCGGGCAGT
TCAGGCGGCT GCACAGCAAG CAGCTGCAGC AGACGTTCCG GTTCTACTCG CAGCAGTGGC GCACCTGGGC GTCCTGCTTC
ATCCAGGCCG CCTGGAGGAG GCACCTCAAG CGCAGGGCCG CCGAGCAGCG CCGCCGCGAG GAGGAGGAGG AGGAGGAGGC
CGCGTCGGCG TCGTCGTCCT GCCAGATCAC CACCACCGTC CTCGTATCGC GCTTCGCCAA GAACGCCATG CGCGGCGCGC
AGCGGCAACG GTCGCGCCGG GACGCCAACC TCATCGTCCT GCCCAAACCG CCGGAGCCTG ACTTCCAGAC CATGGAGTAC
TGATTGGTAG TGTCGAATTA TACACAACAT GCAAATCTTG ATGGAGAGGA AACCAATTAT ACTTTTGTCA GTCTGGCTGT
ACCGCTGGGG GGATTTGCAA TTATAACACT GCTGCAGCAA ATTTCTTATT TACTTTACAT GTTGAGGTAC CACCACCCCT
GGCCAGGAGA TTATCATACA ATCCGTGCAG AATACTGGAC AGATTCAAGC AGTGGCACAT GAACAAAATG CAAGACGATC
ATCACAAATT CACAAGTAGT TCATCCGATT GGGTAGGTTG ATGCCAGCTC GCGCTAGAAG GTCCCTTGCT ATTTTTTCAG
CTGAAGCAAT TACCTCCTCC TGGAATAGAC CACAGGAAAA GTAAAAAACA GAGCCACAGA GGCCAGAGTG TGAGAGACAC
AATCAGTTTT CAGTGCATTA TAGGTACTTA AGCAGGGTGT AAAATTATTG GTTGGTGAAC CAGACAATTA TATACCAAAG
CCTATTTTTA GCATATGGTC AGCTAGGGGT AGGACTGTTG GAGTACCGTT TCTACTTTCT AACCATTAGA AATCTGAACT
TCAGAAGTGT TTATTCCTCA TGAATGTTTT GACATTACCT GTTCTAGTTT AACCAGTTCG TGAATTGTTG GCATGCAATT
ATGTTCATCG TGTTTACTGT TTAATCTAGC ATATTTGGCT C