Os12t0488900-01

Locus

Os12g0488900

Description

Armadillo-like helical domain containing protein.

RAP-DB Gene Symbol Synonym(s)

RAP-DB Gene Name Synonym(s)

CGSNL Gene Symbol

CGSNL Gene Name

Oryzabase Gene Symbol Synonym(s)

OsPuf4

Oryzabase Gene Name Synonym(s)

RNA-binding protein of the Puf family member 4

Transcript Evidence

AK068902 (DDBJ, Best hit)

Protein Evidence

B8BPQ1 (UniProt)

Literature

Note

Manual Curation

Gene Ontology (GO)

Molecular Function: RNA binding (GO:0003723)

Molecular Function: binding (GO:0005488)

Functional domain (InterPro)

Pumilio RNA-binding repeat (IPR001313)

Armadillo-like helical (IPR011989)

Armadillo-type fold (IPR016024)

Full-length cDNA

J023001H05 (Online Clone Ordering)

Expression Databases

TENOR (Os12t0488900-01)

RiceXPro (AK068902)

Others

Oryzabase (9406)

KEGG (Os12t0488900-01)

Transcript

2603 bp

>Os12t0488900-01 Armadillo-like helical domain containing protein.
CTCTCCTATTTTCATCAGCTTCCCTTGCAAGCCTTGCTCCTCCTCCTCCTCCTCCTCCAA
AGTCCCCCCAAAATCGGCGCCTCCCCGTCCAATTCTCCGCCGCGATCCGCTCCCCGAACC
CGCCGGAGCGCGCAGGACCGCGCGGGGACGCCCCGGGCGCGAATGCGCGCGCCCCCTGCG
AGGGTTGGAGATTGTTGTCCTGCTACTGAGATGGATGAAGTGCCGGGTAATCAAGAAGAT
CCCAGACTTGGGGCCTATGCCGACAAGATCACTGATGCGATGTTTGCGGACCATGTGGAG
TTGGGGTCTCATTATGCAGGTGATTCTTCTTCAGAGGCAGGATGGGCTCCAATGATCGCG
AGAATGCAGTCGCAGTCGCAGCTGGGGAGTAACCAGCTTGGTGTCTCCTTTGAGAATGGC
AGTTTGCCAGATGACCCGGCGTCGTTGGCATCGGCATTCAAGAACATGAGCTTGGGATTC
AGGGATTTTACTGTTGGCACTCCTGCTAATCCTGTCAGTGTTGCACCCCTAGGTGGACAT
TATCCTGCAAGTCATGTGATTTCATCTGGTGAGACCACAATGAACTCATTTCATCAGCAG
GAGTTTGCTCAAGATGGTTTCAGGCCTTCATCTCTGAATCCCAATGTTGCTGAATACATG
AAGCCGAAGTACGGTGTACACAATGTTCAGATGTGCACCGGGCTGCATGGCTCGGATTAT
GTTTCTGGGGACCCGTATAATCTACCATCATCAGCTTCACCTTTACAGAAACAGTATTTT
ATTGATGGGCAATTCCGGGCTAATGCACCATATCAGCAGACTGGCTCGAATTTCATGAGG
CAAGATTTTGATGCTGACAGTCATTATCTTTTGCAATCCCAGTATGCTTATCAGCAAATG
CCACAGGTCGCTGGATCTGATGTTCATTGGGTTAGAAGCAACCAACATGGTGTTCACTCT
TCTATCCCTGCAGCTTCACCTTATCTCAGGACACCAATGGTTGGTCAGCAAGCACATAGC
AGTGCTGATACTTACTGGAATGGTGCTGCTATTTCACATGGAAACAACCAGCTGAATTCC
ACATTTGTGAACAATTGCTCATGTATAATTTACCCTGATTGTTCACGCGAAATCTGCGAA
TATTGCCAGATGAAGCAAGCAGAAAAGTTGAAGCATCGTTATATGTTCAGGCGTTCATCC
AAAGGTTTCCTGCAGCCTCAGATTTTTGATAAGGTCAACATTAAATGTTTTCCTGGAAAG
ACGATGGTGAAGTCTGATGATATAAATTCAGCGAGAAATATTCAGTCTGTCTTTGAACCT
AATGGCCGCATTGAAATGAATCAGAGAATTAACCAGCATGGACACAATCAACATCTTAAT
ATTCAGGGCAACGATTTCTTGCTTTTTGACAGGCTAAACTCCCAGGCTCTGTCACCTGTG
GAATCTGAATATGGTTTGGCCATGAAAATTCCTCAAATGAGTTATAGTTCAGTAGATGAA
GTTGTTGGGAAAATTCATCTCTTGGCAAAGGATCAGAATGGCTGCCGCTTCCTACAGAGG
ATATTTACAGAAGGTACTTCGGAGAATGTTAAAAAGGTCTTTGATGGAATCATTGAACAT
ATTGGTGAACTTGTGGTCGATCCATTTGGAAACTACTTGGTACAAAAGCTACTTGAAGAG
TGCAACCATGATCAGAAGATGCATATAGTCTATGAAATAACCAAAAGACCAGGGCAGCTT
ATTAAATTTTCATGCGACATGCATGGGACACGTGTAGTGCAAAAGGTGATAGAAACAATA
AACTCGCCAGATGAAGTTTCCATGGTTGTATGTGCCCTGAGCTCTGGTGCCATCACTTTG
ATGATGGATGCAAATGGCTGTCATGTTGCACTCCGCTGCTTGCAAAAATTCTCACATGAG
CACAAAGCATTCCTTCTTAATGTGGCCATGGAATATTACTTTGAGCTAGCCCAGGATCGT
CAAGGTTGTTGTATCATTCAAAAATGCATTCTTCATGCAAATAAGGAACAGAAGAACCAG
TTGTTGTACAATATCACTTCCAGGGCTCTTGAGCTGTCAGAGCATCAGTATGGGAACTAT
GTTGTACAGTATATTCTTGATCTCCACATTTCATGGGCGACAGATGAAATACTGGACAAG
CTGGAAGATCATTTCGGATCTCTGTCGATGCAAAAAAGTAGCAGCAATGTGGTAGAGAAA
TGTTTAAAAGAAGCATCGTGGCCTAAACGTGTTAAAATCATTCACGAGCTTATCAATGAC
CCTAAGTTACTGCATATCTTGATCGACCCATATGGGAACTATGTGATCCAAACAGCGCTC
AAGGAGTGTGAGGATGCTGCAGTACGCGCTGTGCTGATCGGAGCCATTAGGCCACATGTT
GCTGCTCTTCGAAACAACATGTTTGGGAAGAGAATTCTGTCAAAAACTTACCTGAAGAAC
AGGAAGCACTAATCTTGCACCTTTGGGCTTTTCTTCTGGAGTCCACCTGTCAGGCAATGT
GCATAAGGTGCAACACTAATGTATCTGTAAGAATCATATGCTACAGAATAGATCCACTCA
AATTAAGTAGATTAAGAAAGATG

CDS

2310 bp

>Os12t0488900-01 Armadillo-like helical domain containing protein.
ATGCGCGCGCCCCCTGCGAGGGTTGGAGATTGTTGTCCTGCTACTGAGATGGATGAAGTG
CCGGGTAATCAAGAAGATCCCAGACTTGGGGCCTATGCCGACAAGATCACTGATGCGATG
TTTGCGGACCATGTGGAGTTGGGGTCTCATTATGCAGGTGATTCTTCTTCAGAGGCAGGA
TGGGCTCCAATGATCGCGAGAATGCAGTCGCAGTCGCAGCTGGGGAGTAACCAGCTTGGT
GTCTCCTTTGAGAATGGCAGTTTGCCAGATGACCCGGCGTCGTTGGCATCGGCATTCAAG
AACATGAGCTTGGGATTCAGGGATTTTACTGTTGGCACTCCTGCTAATCCTGTCAGTGTT
GCACCCCTAGGTGGACATTATCCTGCAAGTCATGTGATTTCATCTGGTGAGACCACAATG
AACTCATTTCATCAGCAGGAGTTTGCTCAAGATGGTTTCAGGCCTTCATCTCTGAATCCC
AATGTTGCTGAATACATGAAGCCGAAGTACGGTGTACACAATGTTCAGATGTGCACCGGG
CTGCATGGCTCGGATTATGTTTCTGGGGACCCGTATAATCTACCATCATCAGCTTCACCT
TTACAGAAACAGTATTTTATTGATGGGCAATTCCGGGCTAATGCACCATATCAGCAGACT
GGCTCGAATTTCATGAGGCAAGATTTTGATGCTGACAGTCATTATCTTTTGCAATCCCAG
TATGCTTATCAGCAAATGCCACAGGTCGCTGGATCTGATGTTCATTGGGTTAGAAGCAAC
CAACATGGTGTTCACTCTTCTATCCCTGCAGCTTCACCTTATCTCAGGACACCAATGGTT
GGTCAGCAAGCACATAGCAGTGCTGATACTTACTGGAATGGTGCTGCTATTTCACATGGA
AACAACCAGCTGAATTCCACATTTGTGAACAATTGCTCATGTATAATTTACCCTGATTGT
TCACGCGAAATCTGCGAATATTGCCAGATGAAGCAAGCAGAAAAGTTGAAGCATCGTTAT
ATGTTCAGGCGTTCATCCAAAGGTTTCCTGCAGCCTCAGATTTTTGATAAGGTCAACATT
AAATGTTTTCCTGGAAAGACGATGGTGAAGTCTGATGATATAAATTCAGCGAGAAATATT
CAGTCTGTCTTTGAACCTAATGGCCGCATTGAAATGAATCAGAGAATTAACCAGCATGGA
CACAATCAACATCTTAATATTCAGGGCAACGATTTCTTGCTTTTTGACAGGCTAAACTCC
CAGGCTCTGTCACCTGTGGAATCTGAATATGGTTTGGCCATGAAAATTCCTCAAATGAGT
TATAGTTCAGTAGATGAAGTTGTTGGGAAAATTCATCTCTTGGCAAAGGATCAGAATGGC
TGCCGCTTCCTACAGAGGATATTTACAGAAGGTACTTCGGAGAATGTTAAAAAGGTCTTT
GATGGAATCATTGAACATATTGGTGAACTTGTGGTCGATCCATTTGGAAACTACTTGGTA
CAAAAGCTACTTGAAGAGTGCAACCATGATCAGAAGATGCATATAGTCTATGAAATAACC
AAAAGACCAGGGCAGCTTATTAAATTTTCATGCGACATGCATGGGACACGTGTAGTGCAA
AAGGTGATAGAAACAATAAACTCGCCAGATGAAGTTTCCATGGTTGTATGTGCCCTGAGC
TCTGGTGCCATCACTTTGATGATGGATGCAAATGGCTGTCATGTTGCACTCCGCTGCTTG
CAAAAATTCTCACATGAGCACAAAGCATTCCTTCTTAATGTGGCCATGGAATATTACTTT
GAGCTAGCCCAGGATCGTCAAGGTTGTTGTATCATTCAAAAATGCATTCTTCATGCAAAT
AAGGAACAGAAGAACCAGTTGTTGTACAATATCACTTCCAGGGCTCTTGAGCTGTCAGAG
CATCAGTATGGGAACTATGTTGTACAGTATATTCTTGATCTCCACATTTCATGGGCGACA
GATGAAATACTGGACAAGCTGGAAGATCATTTCGGATCTCTGTCGATGCAAAAAAGTAGC
AGCAATGTGGTAGAGAAATGTTTAAAAGAAGCATCGTGGCCTAAACGTGTTAAAATCATT
CACGAGCTTATCAATGACCCTAAGTTACTGCATATCTTGATCGACCCATATGGGAACTAT
GTGATCCAAACAGCGCTCAAGGAGTGTGAGGATGCTGCAGTACGCGCTGTGCTGATCGGA
GCCATTAGGCCACATGTTGCTGCTCTTCGAAACAACATGTTTGGGAAGAGAATTCTGTCA
AAAACTTACCTGAAGAACAGGAAGCACTAA

Protein

770 aa

>Os12t0488900-01 Armadillo-like helical domain containing protein.
MRAPPARVGDCCPATEMDEVPGNQEDPRLGAYADKITDAMFADHVELGSHYAGDSSSEAG
WAPMIARMQSQSQLGSNQLGVSFENGSLPDDPASLASAFKNMSLGFRDFTVGTPANPVSV
APLGGHYPASHVISSGETTMNSFHQQEFAQDGFRPSSLNPNVAEYMKPKYGVHNVQMCTG
LHGSDYVSGDPYNLPSSASPLQKQYFIDGQFRANAPYQQTGSNFMRQDFDADSHYLLQSQ
YAYQQMPQVAGSDVHWVRSNQHGVHSSIPAASPYLRTPMVGQQAHSSADTYWNGAAISHG
NNQLNSTFVNNCSCIIYPDCSREICEYCQMKQAEKLKHRYMFRRSSKGFLQPQIFDKVNI
KCFPGKTMVKSDDINSARNIQSVFEPNGRIEMNQRINQHGHNQHLNIQGNDFLLFDRLNS
QALSPVESEYGLAMKIPQMSYSSVDEVVGKIHLLAKDQNGCRFLQRIFTEGTSENVKKVF
DGIIEHIGELVVDPFGNYLVQKLLEECNHDQKMHIVYEITKRPGQLIKFSCDMHGTRVVQ
KVIETINSPDEVSMVVCALSSGAITLMMDANGCHVALRCLQKFSHEHKAFLLNVAMEYYF
ELAQDRQGCCIIQKCILHANKEQKNQLLYNITSRALELSEHQYGNYVVQYILDLHISWAT
DEILDKLEDHFGSLSMQKSSSNVVEKCLKEASWPKRVKIIHELINDPKLLHILIDPYGNY
VIQTALKECEDAAVRAVLIGAIRPHVAALRNNMFGKRILSKTYLKNRKH*

5'UTR

chr12:18318896..18319057 (- strand) : 162 bp

CDS

chr12:18318868..18318895 (- strand) : 28 bp

chr12:18316583..18318158 (- strand) : 1576 bp

chr12:18316353..18316515 (- strand) : 163 bp

chr12:18315872..18316035 (- strand) : 164 bp

chr12:18315533..18315791 (- strand) : 259 bp

chr12:18315328..18315447 (- strand) : 120 bp

3'UTR

chr12:18315197..18315327 (- strand) : 131 bp

FASTA

>Os12t0488900-01 class=Sequence position=chr12:18315197..18319057 (- strand)
CTCTCCTATT TTCATCAGCT TCCCTTGCAA GCCTTGCTCC TCCTCCTCCT CCTCCTCCAA AGTCCCCCCA AAATCGGCGC
CTCCCCGTCC AATTCTCCGC CGCGATCCGC TCCCCGAACC CGCCGGAGCG CGCAGGACCG CGCGGGGACG CCCCGGGCGC
GAATGCGCGC GCCCCCTGCG AGGGTTGGAG GTGATCTTTC CTCTGCCGTT TTCTTTGGGT GGGGGTTTGT GTGTGTCGAT
TTGGGGGGAT TTCGTCGATT GGTTCTTGCG AGGATCGGTG TTCTTGCGGT GGGTTTCGGT GGGGGGCCCG GTTCTTGATT
TGAGATGGGG GGTTTTGGGG GGTGTTGGGT GATCGGGCGG GGGGTTTTCT TGGGGTTTTT GCGATCTTGG CGTGCGTGGG
TGGGTTTTCT TGGCGACCAA CTACCCCCGC AGTTTTGTGA CGGATTTCGT TTGATCCTCG TGGGACGCGA TCGTGGCTTC
GATGGGGGGA AATCGTGGGT TTCTTTTTGG TGGTTCCCTT ATCGGAATTT AGTTATGAGT GCGTGCGTTT CTTGGGTTTC
TTGGGATTTG GGATTGCTTT GTGTTTTCTT TTTTGATGGG ATCAAAAATC TTTTTCTCTT CGTCCATTTG GCCGGGAGAA
CTGTGTTGAT TCCAAGATCT TCAGACGGAC GCCCTGCTGA TGTTGTCGTT ATGCCAAAAT TGCTCGTACA AATGCTAATT
TTACTATTTG GTAAATGTTT TTTAATCGCT TCGATGATCA TTTGATTGAT CGATGATGCT GGTCATTTCG CGGTATTTGC
GTGTAGTGTG GAATCGTCGG TGCCGTGGGA TTGGTGATTC TGTCCTACAT TGTCTGATAG ATTTGGCATT GACTGTGTCC
TGCCTCTGCT GCTCTGCAGA TTGTTGTCCT GCTACTGAGA TGGATGAAGT GCCGGGTAAT CAAGAAGATC CCAGACTTGG
GGCCTATGCC GACAAGATCA CTGATGCGAT GTTTGCGGAC CATGTGGAGT TGGGGTCTCA TTATGCAGGT GATTCTTCTT
CAGAGGCAGG ATGGGCTCCA ATGATCGCGA GAATGCAGTC GCAGTCGCAG CTGGGGAGTA ACCAGCTTGG TGTCTCCTTT
GAGAATGGCA GTTTGCCAGA TGACCCGGCG TCGTTGGCAT CGGCATTCAA GAACATGAGC TTGGGATTCA GGGATTTTAC
TGTTGGCACT CCTGCTAATC CTGTCAGTGT TGCACCCCTA GGTGGACATT ATCCTGCAAG TCATGTGATT TCATCTGGTG
AGACCACAAT GAACTCATTT CATCAGCAGG AGTTTGCTCA AGATGGTTTC AGGCCTTCAT CTCTGAATCC CAATGTTGCT
GAATACATGA AGCCGAAGTA CGGTGTACAC AATGTTCAGA TGTGCACCGG GCTGCATGGC TCGGATTATG TTTCTGGGGA
CCCGTATAAT CTACCATCAT CAGCTTCACC TTTACAGAAA CAGTATTTTA TTGATGGGCA ATTCCGGGCT AATGCACCAT
ATCAGCAGAC TGGCTCGAAT TTCATGAGGC AAGATTTTGA TGCTGACAGT CATTATCTTT TGCAATCCCA GTATGCTTAT
CAGCAAATGC CACAGGTCGC TGGATCTGAT GTTCATTGGG TTAGAAGCAA CCAACATGGT GTTCACTCTT CTATCCCTGC
AGCTTCACCT TATCTCAGGA CACCAATGGT TGGTCAGCAA GCACATAGCA GTGCTGATAC TTACTGGAAT GGTGCTGCTA
TTTCACATGG AAACAACCAG CTGAATTCCA CATTTGTGAA CAATTGCTCA TGTATAATTT ACCCTGATTG TTCACGCGAA
ATCTGCGAAT ATTGCCAGAT GAAGCAAGCA GAAAAGTTGA AGCATCGTTA TATGTTCAGG CGTTCATCCA AAGGTTTCCT
GCAGCCTCAG ATTTTTGATA AGGTCAACAT TAAATGTTTT CCTGGAAAGA CGATGGTGAA GTCTGATGAT ATAAATTCAG
CGAGAAATAT TCAGTCTGTC TTTGAACCTA ATGGCCGCAT TGAAATGAAT CAGAGAATTA ACCAGCATGG ACACAATCAA
CATCTTAATA TTCAGGGCAA CGATTTCTTG CTTTTTGACA GGCTAAACTC CCAGGCTCTG TCACCTGTGG AATCTGAATA
TGGTTTGGCC ATGAAAATTC CTCAAATGAG TTATAGTTCA GTAGATGAAG TTGTTGGGAA AATTCATCTC TTGGCAAAGG
ATCAGAATGG CTGCCGCTTC CTACAGAGGA TATTTACAGA AGGTACTTCG GAGAATGTTA AAAAGGTCTT TGATGGAATC
ATTGAACATA TTGGTGAACT TGTGGTCGAT CCATTTGGAA ACTACTTGGT ACAAAAGCTA CTTGAAGAGT GCAACCATGA
TCAGAAGATG CATATAGTCT ATGAAATAAC CAAAAGACCA GGGCAGCTTA TTAAATTTTC ATGCGACATG CATGGGTATG
TATGTGGTAC TCTGATATTA ACTGTTTTGC TCACAATTAA CTATTTTTCT GCACATATCC AGGACACGTG TAGTGCAAAA
GGTGATAGAA ACAATAAACT CGCCAGATGA AGTTTCCATG GTTGTATGTG CCCTGAGCTC TGGTGCCATC ACTTTGATGA
TGGATGCAAA TGGCTGTCAT GTTGCACTCC GCTGCTTGCA AAAATTCTCA CATGAGCACA AAGCAGTAAG ATATCTTTGC
TTTAAATTGA ACGTATTATT ATTCTTTGTA TGGCAGCTGT GCAAACTCTT GCCTACATTA GCTGTATAAT GCTAGTTTTG
TTATAATGAT GTGGATAGAT TGAAACTATC AATCGTCATG GTTTGTAGCA GTCATGCTGA GAAATATGTA TATTATAGAG
GGACTGGCAT AGAATATATT ATAATTCTAA TGCCATTGTA GAGCAGGAAA ACGATATAGT AAGACAATAA TGGTTATAGA
GTCCACCTTT TTCATAATTT TAAATAGTCT ATCTCAAATT TGGACTGGTA TAACCATTGC AGTTCCTTCT TAATGTGGCC
ATGGAATATT ACTTTGAGCT AGCCCAGGAT CGTCAAGGTT GTTGTATCAT TCAAAAATGC ATTCTTCATG CAAATAAGGA
ACAGAAGAAC CAGTTGTTGT ACAATATCAC TTCCAGGGCT CTTGAGCTGT CAGAGCATCA GTATGGGTAT GCACATTCTC
TTTTGCCTTC TGAAGTTCAA GAGATTGTTG TCTACTCACA GTCCTAGGGC AATATTTTCC TTTCAGGAAC TATGTTGTAC
AGTATATTCT TGATCTCCAC ATTTCATGGG CGACAGATGA AATACTGGAC AAGCTGGAAG ATCATTTCGG ATCTCTGTCG
ATGCAAAAAA GTAGCAGCAA TGTGGTAGAG AAATGTTTAA AAGAAGCATC GTGGCCTAAA CGTGTTAAAA TCATTCACGA
GCTTATCAAT GACCCTAAGT TACTGCATAT CTTGATCGAC CCATATGGGA ACTATGTGAT CCAAACAGCG CTCAAGGAGT
GTGAGGTAAG AAAAAATGCT GCCGTTCTGC GACAAGCATA CGAACATTAG ATTAATTTCA CATTTTAACT CCAACTGTGC
TATTGTGCAG GATGCTGCAG TACGCGCTGT GCTGATCGGA GCCATTAGGC CACATGTTGC TGCTCTTCGA AACAACATGT
TTGGGAAGAG AATTCTGTCA AAAACTTACC TGAAGAACAG GAAGCACTAA TCTTGCACCT TTGGGCTTTT CTTCTGGAGT
CCACCTGTCA GGCAATGTGC ATAAGGTGCA ACACTAATGT ATCTGTAAGA ATCATATGCT ACAGAATAGA TCCACTCAAA
TTAAGTAGAT TAAGAAAGAT G